(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE191

PENCW_10.PE191       Location/Qualifiers
FT   CDS             443096..443572
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129225"
FT                   /orf_name="Pc13g01910"
FT                   /product="Pc13g01910 protein"
FT                   /protein_id="CAP91260.1"
FT                   /db_xref="UniParc:UPI0001830906"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B1"
FT                   /transl_table=1
FT                   /translation="MCNRIEFKQFSFLSFIIPQFNDCSCVSVADLRSRPAYVVVYTGRL
FT                   FSDSMWDSLGMNPFSPGLPTLNIPEITDPSTFDIGVTTDTVNPRSTLEISRARDLVFTR
FT                   LSSLQQTLPHRRMDGTLQSVIAIWEEYDSRKADSSSIVHWLDVMREKGLVITLW"
     MCNRIEFKQF SFLSFIIPQF NDCSCVSVAD LRSRPAYVVV YTGRLFSDSM WDSLGMNPFS        60
     PGLPTLNIPE ITDPSTFDIG VTTDTVNPRS TLEISRARDL VFTRLSSLQQ TLPHRRMDGT       120
     LQSVIAIWEE YDSRKADSSS IVHWLDVMRE KGLVITLW                               158
//

If you have problems or comments...

PBIL Back to PBIL home page