(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE192

PENCW_10.PE192       Location/Qualifiers
FT   CDS             join(complement(445074..445433),complement(443747..445030))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202868" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949814"
FT                   /orf_name="Pc13g01920"
FT                   /product="Pc13g01920 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91261.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830907"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B2"
FT                   /transl_table=1
FT                   /translation="MWPLNSKKDDNDTKIANPEPETKDDLESAHIEKIDASIDNIATSI
FT                   DNLPVSWFVWLAALTASMAGLLFGYDTGIISGVLVVLGDSLDGRPATSSEKEMITSLCS
FT                   GGAFIGAIFAGNTADRFGRKMAIYLGCVLFIAGAVLQAAAYTIVQMAIGRLVIGFGVGC
FT                   GAMVLPLYVAEIAPAKARGKLIGLNNMSITGGQVISYAIGAAFASVPHGWRYMVGLGGV
FT                   PAVVLGVLMPFCPESPRHLAYNGRRDEARVVLRKIYAKATEDQIDAVLLSICTACDQAR
FT                   EINESGSRFSKIKKLHTVPSNLRALVSACGLMVISQLSGFNALMYYSATLFSLVGFDNP
FT                   TAVGLVVAGTNFIMTFVNMMVIDGMGRRKLLLSTVWGMSVGMVAIAVAFRWIPINMETM
FT                   EVTTTGISPAAIAVLVFIIWFVVFYGVSVGNTAWMSTDFFPLEVRAMGTMWLTCSNWGA
FT                   NVIISSTFLSMMKAWTTSGAFGFFAAICGLGYIWIYFFYPEVSGLVLEEVKEVFEHGFG
FT                   VDYARQLRKERKDIIEERMKTQEKPIAVGH"
     MWPLNSKKDD NDTKIANPEP ETKDDLESAH IEKIDASIDN IATSIDNLPV SWFVWLAALT        60
     ASMAGLLFGY DTGIISGVLV VLGDSLDGRP ATSSEKEMIT SLCSGGAFIG AIFAGNTADR       120
     FGRKMAIYLG CVLFIAGAVL QAAAYTIVQM AIGRLVIGFG VGCGAMVLPL YVAEIAPAKA       180
     RGKLIGLNNM SITGGQVISY AIGAAFASVP HGWRYMVGLG GVPAVVLGVL MPFCPESPRH       240
     LAYNGRRDEA RVVLRKIYAK ATEDQIDAVL LSICTACDQA REINESGSRF SKIKKLHTVP       300
     SNLRALVSAC GLMVISQLSG FNALMYYSAT LFSLVGFDNP TAVGLVVAGT NFIMTFVNMM       360
     VIDGMGRRKL LLSTVWGMSV GMVAIAVAFR WIPINMETME VTTTGISPAA IAVLVFIIWF       420
     VVFYGVSVGN TAWMSTDFFP LEVRAMGTMW LTCSNWGANV IISSTFLSMM KAWTTSGAFG       480
     FFAAICGLGY IWIYFFYPEV SGLVLEEVKE VFEHGFGVDY ARQLRKERKD IIEERMKTQE       540
     KPIAVGH                                                                 547
//

If you have problems or comments...

PBIL Back to PBIL home page