(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE193

PENCW_10.PE193       Location/Qualifiers
FT   CDS             join(complement(448110..448506),complement(446823..448036))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000181424" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949815"
FT                   /orf_name="Pc13g01930"
FT                   /product="Pc13g01930 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91262.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002591"
FT                   /db_xref="InterPro:IPR017849"
FT                   /db_xref="InterPro:IPR017850"
FT                   /db_xref="UniParc:UPI0001830908"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B3"
FT                   /transl_table=1
FT                   /translation="MGFCNWATVIANLLVPLGILTFSSGFFPYKPLIPGLATFDETGEN
FT                   VTVPAVFDKVIFMVVDALRRCLHIATLYIRMTRVSYLHRGDLIRSGAALPFTAYASAPT
FT                   VTMPRLKAITTGSVPSFLDVILNIAESDTTSTLAYQDTWLAQLKAIGGRLVMYGDDTWL
FT                   KLFPGMFDRADGTTSFFVSDFTEVDHNVTRHVPNELARDDWSALIMHYLGLDHIGHKAG
FT                   PKSPFMLPKQHEMDSVVTDIYTAMQQQHHLQSTLFVLCGDHGMNEAGNHGGSSAGETSP
FT                   ALLLMSPKFEALGRRESPVEPSGDMQYYQTVEQADIAPTLAGLLGIPIPLNSLGVFIPD
FT                   FLDMWDNGSHKLRILRQNAEQLLNTLTTTFPGFTFDSDISTSCASEALSAIEEARCAWA
FT                   RVQRLIYDKDEAGDSYSTVGPALLHFLRIAQEVMSRTASNYDVSRLILGLLITGAAGLL
FT                   VLPATYKECTRHGSSGLFLMLMIVTCGMMMFASSYVEEEQQFWYWICSGWIVYLHIKSQ
FT                   SSAKPVSHKRFGSLLYCIFRPHDTIHETLHIFLMTQSRATNVPLFLIFRIQAGILSSMN
FT                   LTGIEVTITTLVFQYMTFFAFGGSNAISSVDLASGYNGVGSYSVVLVGVLTFASNWAGP
FT                   IWWASQSHRLRPKNPAEQNPSALLTFHVAMSLVSVMAACTALRTHLFIWTVFSPKYLYS
FT                   MAWATANHVAVNLLGEAIFSRSQSRYHYS"
     MVHIIKTLAV GLLACVAHAF NYDQLYRGQY HFSPQDNWMN DPSGLLYHNE IYHLFFQYNP        60
     SGIQWGNLSW GHATSKDLTH WEEQPVALLA RGHSGNVTEM YFTGSAIVDM NNTSGFRKDR       120
     KTPIVAMYTS FILAQTLPSG KTIQENQQAQ SIAYSLDDGM TXTTYDNSNP VIHNPPAPYQ       180
     DQYKEFRDPF VFXHKESEQW VIIAALAVIH KFVIYTSDNL KDXKLASEFG PYNAQGGVWE       240
     CPGLFQLPLD RGKSTKXILT AGLNPSGPPG TVGSRTQYFV GDFDGTTFSP DADSVYHGDA       300
     TTNXMDXGPD FYTAAGYNSV PIDALVQIGX INNXQYSANI PTGSWRGATA IPRHLALRTI       360
     GDKVTLVQQP QEAWSSIVNK RAAYSHKYNS MLEGSVHLGT TSETIKIDLS FSAASTASKF       420
     AIAVRGSADF TKQTLVGYDF VNKQVFIDRT KSGDVSFDNT FASVYRGPLA ADVNGKVNLS       480
     IFVDRSSVEV FGGQGETTLT AQIFPSRDAI NTQLVSTGGT TKSVKIDIFN VASTWN           536
//

If you have problems or comments...

PBIL Back to PBIL home page