(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE194

PENCW_10.PE194       Location/Qualifiers
FT   CDS             449919..451004
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000252609" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949816"
FT                   /orf_name="Pc13g01940"
FT                   /product="Pc13g01940 protein"
FT                   /function="electron carrier activity"
FT                   /function="molybdenum ion binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91263.1"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0030151"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000572"
FT                   /db_xref="InterPro:IPR005066"
FT                   /db_xref="InterPro:IPR008335"
FT                   /db_xref="InterPro:IPR014756"
FT                   /db_xref="UniParc:UPI0001830909"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B4"
FT                   /transl_table=1
FT                   /translation="MSTNESRNESSLAESSRVGRAQNECVTIYRPSQHREAPPPHKQQE
FT                   YITHDTLLFEEMHMGIAVVDIAKWRLVVDGMVENPFSISLPELCALPKLSVVAFHECYG
FT                   SPLRPSDRNIWRVGNVTWTGVPLKFLLNIAQPLGSARYMWSEGLDHGAFAGKKITCYQK
FT                   DVPLEKAMSDEVLVAYEVNSEPLRRERGGPVRLVVPGWFGTNSTKWLWRLSFQAQRAPG
FT                   IFASHYYNRPNPQGGIQPVWEVEPNSMIIDPSPNAKVVGPRVMIRGWAWSWDGIEAVQI
FT                   RQSGKSEWQQAETKPRQDFSWQAFRHFIVLPKGRCSVVAQAISRSGKMQPLENQRNCAH
FT                   NVDFEVIVESEGRIHQITDSL"
     MSTNESRNES SLAESSRVGR AQNECVTIYR PSQHREAPPP HKQQEYITHD TLLFEEMHMG        60
     IAVVDIAKWR LVVDGMVENP FSISLPELCA LPKLSVVAFH ECYGSPLRPS DRNIWRVGNV       120
     TWTGVPLKFL LNIAQPLGSA RYMWSEGLDH GAFAGKKITC YQKDVPLEKA MSDEVLVAYE       180
     VNSEPLRRER GGPVRLVVPG WFGTNSTKWL WRLSFQAQRA PGIFASHYYN RPNPQGGIQP       240
     VWEVEPNSMI IDPSPNAKVV GPRVMIRGWA WSWDGIEAVQ IRQSGKSEWQ QAETKPRQDF       300
     SWQAFRHFIV LPKGRCSVVA QAISRSGKMQ PLENQRNCAH NVDFEVIVES EGRIHQITDS       360
     L                                                                       361
//

If you have problems or comments...

PBIL Back to PBIL home page