(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE195

PENCW_10.PE195       Location/Qualifiers
FT   CDS             complement(451974..452741)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000218797" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949817"
FT                   /orf_name="Pc13g01950"
FT                   /product="Pc13g01950 protein"
FT                   /function="FMN binding"
FT                   /protein_id="CAP91264.1"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="InterPro:IPR007396"
FT                   /db_xref="InterPro:IPR009002"
FT                   /db_xref="InterPro:IPR012349"
FT                   /db_xref="UniParc:UPI000183090A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B5"
FT                   /transl_table=1
FT                   /translation="MFLPPVHAETEIAVLFQFIRENPLGMLITGIKSSQEFLQCTHAPF
FT                   VLDLPEETTGSPLQGRLRAHIAKQNPQVKAMIEELVTKPNILELEDNVLVVFNGKYNHY
FT                   VTPKYYVETKPDTGKVVPTWNYSAVQVYGKLSLYYDSKTPEAGAFLAKQMDDLSQHAEK
FT                   SVMGHMGGEKPQPWKVSDAPEKYIELMQRNIVGIEIRIEKVQGKFKMSQEMKPGDREGV
FT                   VAGFTRMGGENAEGMANLVEERGALHDSRAQSG"
     MFLPPVHAET EIAVLFQFIR ENPLGMLITG IKSSQEFLQC THAPFVLDLP EETTGSPLQG        60
     RLRAHIAKQN PQVKAMIEEL VTKPNILELE DNVLVVFNGK YNHYVTPKYY VETKPDTGKV       120
     VPTWNYSAVQ VYGKLSLYYD SKTPEAGAFL AKQMDDLSQH AEKSVMGHMG GEKPQPWKVS       180
     DAPEKYIELM QRNIVGIEIR IEKVQGKFKM SQEMKPGDRE GVVAGFTRMG GENAEGMANL       240
     VEERGALHDS RAQSG                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page