(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE196

PENCW_10.PE196       Location/Qualifiers
FT   CDS             join(453284..453655,453721..453787,453950..454134)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235081" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949818"
FT                   /orf_name="Pc13g01960"
FT                   /product="Pc13g01960 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91265.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR000991"
FT                   /db_xref="UniParc:UPI000183090B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B6"
FT                   /transl_table=1
FT                   /translation="MSRPTPLRIAVLINTPSDDYDFWTDVRQAWQESFAKVAPNAEVDF
FT                   YDPVFERAFPDASKYDLIALSGGKADASSSDPWVLGVLDFVRTVVRDHPKTKILGVCWG
FT                   HQAVARALGGEVGAVPTGPIAAIQDIALTDAGKKFLTFATSAVLSFQAHPEISNRLAKK
FT                   MLLADDKEYNGNSTAEQLKAEVQKLDQPTDGVKLLKRVIQWLDE"
     MSRPTPLRIA VLINTPSDDY DFWTDVRQAW QESFAKVAPN AEVDFYDPVF ERAFPDASKY        60
     DLIALSGGKA DASSSDPWVL GVLDFVRTVV RDHPKTKILG VCWGHQAVAR ALGGEVGAVP       120
     TGPIAAIQDI ALTDAGKKFL TFATSAVLSF QAHPEISNRL AKKMLLADDK EYNGNSTAEQ       180
     LKAEVQKLDQ PTDGVKLLKR VIQWLDE                                           207
//

If you have problems or comments...

PBIL Back to PBIL home page