(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE197

PENCW_10.PE197       Location/Qualifiers
FT   CDS             join(complement(456868..456957),complement(455215..456816))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235017" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949819"
FT                   /orf_name="Pc13g01970"
FT                   /product="Pc13g01970 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91266.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI000183090C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B7"
FT                   /transl_table=1
FT                   /translation="MYEPAPPRPKKTDIVRSRNGCQSCRKRRTKCDEKKPVCGTCVRLG
FT                   IVCESVKLDLKFRVVTAPPPKKTGAKAEPAEPDSTRLGLQLFGQHSRSPQIPNINLAQS
FT                   LQHTDRDVFYSTYWEDHCLPALHPIFRCASELLGFPALKDAILALSSCNISRIYAERKY
FT                   STSFPTTGTLSPNLIHQTRSQLYYSSAIKKFISLTQDDHRNNAAEVLTILVLFGYIEAS
FT                   MGNFDGYYCHVQGLSAFLVELRETTGYSLYRALLISWLQSQFLIWWARTYFSSLDVQRN
FT                   MPSIDFPRGLEGTSDSFHDLRVVVLSILCESHRLNVKETLKHWRDKTDFEPALASVLQS
FT                   DRDDTEDRFARLQDESKRLDEWLSYLPPSEQPLVGDASETSPIFFQAHDAALNFAYYVV
FT                   ARIMQCISFLRNLPCRDAQHLGSECLEIEPWARLLLRIVQGTDMQTSIIRNNYTIGFSG
FT                   LLLAASLRCQDLSLSMQIEKWLQTLEEKQPTEEGAFPVYQALAVVKAINRQRTMGRDVF
FT                   GVSQTMDDGGGMPKFTHYNSQMITNILVHGKCRSTGDLFTECIDLQ"
     MYEPAPPRPK KTDIVRSRNG CQSCRKRRTK CDEKKPVCGT CVRLGIVCES VKLDLKFRVV        60
     TAPPPKKTGA KAEPAEPDST RLGLQLFGQH SRSPQIPNIN LAQSLQHTDR DVFYSTYWED       120
     HCLPALHPIF RCASELLGFP ALKDAILALS SCNISRIYAE RKYSTSFPTT GTLSPNLIHQ       180
     TRSQLYYSSA IKKFISLTQD DHRNNAAEVL TILVLFGYIE ASMGNFDGYY CHVQGLSAFL       240
     VELRETTGYS LYRALLISWL QSQFLIWWAR TYFSSLDVQR NMPSIDFPRG LEGTSDSFHD       300
     LRVVVLSILC ESHRLNVKET LKHWRDKTDF EPALASVLQS DRDDTEDRFA RLQDESKRLD       360
     EWLSYLPPSE QPLVGDASET SPIFFQAHDA ALNFAYYVVA RIMQCISFLR NLPCRDAQHL       420
     GSECLEIEPW ARLLLRIVQG TDMQTSIIRN NYTIGFSGLL LAASLRCQDL SLSMQIEKWL       480
     QTLEEKQPTE EGAFPVYQAL AVVKAINRQR TMGRDVFGVS QTMDDGGGMP KFTHYNSQMI       540
     TNILVHGKCR STGDLFTECI DLQ                                               563
//

If you have problems or comments...

PBIL Back to PBIL home page