(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE199

PENCW_10.PE199       Location/Qualifiers
FT   CDS             461140..462651
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000167080" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129227"
FT                   /orf_name="Pc13g01990"
FT                   /product="Pc13g01990 protein"
FT                   /function="substrate-specific transmembrane transporter
FT                   activity"
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91268.1"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0022891"
FT                   /db_xref="InterPro:IPR003663"
FT                   /db_xref="InterPro:IPR005828"
FT                   /db_xref="InterPro:IPR005829"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183090E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1B9"
FT                   /transl_table=1
FT                   /translation="MSFELEGTKLSLGVAFTTSCGFLLFGYDQGVFGGLIENGSFQSTF
FT                   RQPSQMVIGQIAATYDLGCFFGAIFCMVYGDRIGRRLSIALGCIVLTIGAVIQTVSFSV
FT                   AQIIVGRFIAGLGNGLNTTAIPVWQSEMSKPQHRGRLAVFHLVLNQLGNVTAQWLNFGL
FT                   GYIGHQQVSWRFPIAFQIFYALVTLVLLPWLPDSSRWLIQKGRLEQAKAVTARLHAKGI
FT                   HDPDLLALHEASVQSVQHELEVSKVSWRTLLQRDSLQTRRRVLLGMGTQFMQQWGGINA
FT                   INYYLPVVFASLQVSRQMSLILSACNAINVMVFTAVALTTIEKVGRKRLMLWGAVGQGT
FT                   CFALLTSGLGVGGSQWSAVAIAFVFAYYTVFGMSWIAVPWMYPAEINTQAWRNRGAGLA
FT                   TATNWICNYAVVLVTPIGIENIDWRYYIIYVVLNFSFVPIVSFWYVETAGLSLEEIDKI
FT                   FEGKTYGIPLDVSEGGATTENEEGKARQDEVNSEWIEAVDSSKRD"
     MSFELEGTKL SLGVAFTTSC GFLLFGYDQG VFGGLIENGS FQSTFRQPSQ MVIGQIAATY        60
     DLGCFFGAIF CMVYGDRIGR RLSIALGCIV LTIGAVIQTV SFSVAQIIVG RFIAGLGNGL       120
     NTTAIPVWQS EMSKPQHRGR LAVFHLVLNQ LGNVTAQWLN FGLGYIGHQQ VSWRFPIAFQ       180
     IFYALVTLVL LPWLPDSSRW LIQKGRLEQA KAVTARLHAK GIHDPDLLAL HEASVQSVQH       240
     ELEVSKVSWR TLLQRDSLQT RRRVLLGMGT QFMQQWGGIN AINYYLPVVF ASLQVSRQMS       300
     LILSACNAIN VMVFTAVALT TIEKVGRKRL MLWGAVGQGT CFALLTSGLG VGGSQWSAVA       360
     IAFVFAYYTV FGMSWIAVPW MYPAEINTQA WRNRGAGLAT ATNWICNYAV VLVTPIGIEN       420
     IDWRYYIIYV VLNFSFVPIV SFWYVETAGL SLEEIDKIFE GKTYGIPLDV SEGGATTENE       480
     EGKARQDEVN SEWIEAVDSS KRD                                               503
//

If you have problems or comments...

PBIL Back to PBIL home page