(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE20

PENCW_10.PE20        Location/Qualifiers
FT   CDS             join(complement(45190..46061),complement(44937..45033))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671650"
FT                   /orf_name="Pc13g00200"
FT                   /product="Pc13g00200 protein"
FT                   /protein_id="CAP91089.1"
FT                   /db_xref="UniParc:UPI0001830D06"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H4"
FT                   /transl_table=1
FT                   /translation="MSAQTETSSMPCPFHKDDQLNGDLDTSLDYLPGHPRIRLGDEKGL
FT                   FEFIRREVWSEDLESISGRLWWMSKQDSSNISPLHRQRVKGRQIIVTEDPRLHLVWIDD
FT                   RIFLKPLPQYITSFVFWDTFMSDPSKLGAAVKLRKAALGYLRTYFYLIQYESDLRIAQD
FT                   PALCLVPKEVTWHRFCQFTARLNDITENEISGRYHYGEIRLTRLNYYAPVLLGKSHYQR
FT                   ENYQYRAYFARIQGPLISAFAFFSIALNCMQVSLAASTSDERYSSALLFAACYWLSTLI
FT                   GFVTGVLMLMLVLKSFLTGDLTEVFSNIDSSVTDFANSTKC"
     MSAQTETSSM PCPFHKDDQL NGDLDTSLDY LPGHPRIRLG DEKGLFEFIR REVWSEDLES        60
     ISGRLWWMSK QDSSNISPLH RQRVKGRQII VTEDPRLHLV WIDDRIFLKP LPQYITSFVF       120
     WDTFMSDPSK LGAAVKLRKA ALGYLRTYFY LIQYESDLRI AQDPALCLVP KEVTWHRFCQ       180
     FTARLNDITE NEISGRYHYG EIRLTRLNYY APVLLGKSHY QRENYQYRAY FARIQGPLIS       240
     AFAFFSIALN CMQVSLAAST SDERYSSALL FAACYWLSTL IGFVTGVLML MLVLKSFLTG       300
     DLTEVFSNID SSVTDFANST KC                                                322
//

If you have problems or comments...

PBIL Back to PBIL home page