(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE200

PENCW_10.PE200       Location/Qualifiers
FT   CDS             join(462938..463012,463078..463160,463216..463559,
FT                   463644..464103,464154..464362,464416..464548,
FT                   464605..464829,464890..465045,465097..465772)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000215643" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129228"
FT                   /orf_name="Pc13g02000"
FT                   /product="Pc13g02000 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91269.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI000183090F"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C0"
FT                   /transl_table=1
FT                   /translation="MPQTKTVKPARKHVTTACIPCRDGKCDGSKPSCKNCESKNKDCTY
FT                   RQRNDKRKIPVRVAVSLLASRVAVLSQHIQNAGFGVPAMDKNDRDTLRGILQSLGIACE
FT                   NVLSDENTSHSAGASFPGSQRPVDTTRFVAHDQTNITSPQPPAPGCDNYHPGGDLPPLH
FT                   ERSAGPSQLSESYRMHVVTPTQFPPNVDVIPSENPETDSEDEVTDQFACRLGRVQLTHD
FT                   GQLRYFGSTSNLNLLDVSDDIRNFTSSLFQKDAQDTLEDLGLNIEVEEAFEKHLLQLYF
FT                   AWQDPCLHVVDSEAFWKAKNQNRYEGLTSAYYSQALCDAMCAMGAAYEPKYHPDLVTFP
FT                   RSLSQFFGDRAKALLELEIENPSLATIQALVICSNYEASGTRDTRGWLYSGMAMRLAFD
FT                   QGLHLDVTPYVEKGIITAEECKIRRTVFWSSSLNDQFWGYYLGRSVRSPVAGVSVRKPC
FT                   WNDRSPMSQQAPRWRSYGCSQVNIQGIANPSDMIFQQWIALYDLMSPVTDVLYGCLEIS
FT                   RTALQELTADTVARLLAWKNNLPNDLNVDATKESYYYLPHVLTLHLQYYQFMIHCHRPY
FT                   ISKNHIQPRPLQGPGPGHARRMCLESAISIVKVLNMYERRYSFRKANVQMVSYVFSAAL
FT                   ILMFVTVPGQSSTQHSDLVRYLSTCFWALDEMGTCFENAKRTSRFLSTLQQQWHKRKRG
FT                   MAQKGAKRGPENENSPGKHPKRSRNTAGTQNWLGDNLCSSAELGVPVAVDSPISHETHD
FT                   LSFFGDNGPDLVEFMDPELCNILLSDGIPRAMN"
     MPQTKTVKPA RKHVTTACIP CRDGKCDGSK PSCKNCESKN KDCTYRQRND KRKIPVRVAV        60
     SLLASRVAVL SQHIQNAGFG VPAMDKNDRD TLRGILQSLG IACENVLSDE NTSHSAGASF       120
     PGSQRPVDTT RFVAHDQTNI TSPQPPAPGC DNYHPGGDLP PLHERSAGPS QLSESYRMHV       180
     VTPTQFPPNV DVIPSENPET DSEDEVTDQF ACRLGRVQLT HDGQLRYFGS TSNLNLLDVS       240
     DDIRNFTSSL FQKDAQDTLE DLGLNIEVEE AFEKHLLQLY FAWQDPCLHV VDSEAFWKAK       300
     NQNRYEGLTS AYYSQALCDA MCAMGAAYEP KYHPDLVTFP RSLSQFFGDR AKALLELEIE       360
     NPSLATIQAL VICSNYEASG TRDTRGWLYS GMAMRLAFDQ GLHLDVTPYV EKGIITAEEC       420
     KIRRTVFWSS SLNDQFWGYY LGRSVRSPVA GVSVRKPCWN DRSPMSQQAP RWRSYGCSQV       480
     NIQGIANPSD MIFQQWIALY DLMSPVTDVL YGCLEISRTA LQELTADTVA RLLAWKNNLP       540
     NDLNVDATKE SYYYLPHVLT LHLQYYQFMI HCHRPYISKN HIQPRPLQGP GPGHARRMCL       600
     ESAISIVKVL NMYERRYSFR KANVQMVSYV FSAALILMFV TVPGQSSTQH SDLVRYLSTC       660
     FWALDEMGTC FENAKRTSRF LSTLQQQWHK RKRGMAQKGA KRGPENENSP GKHPKRSRNT       720
     AGTQNWLGDN LCSSAELGVP VAVDSPISHE THDLSFFGDN GPDLVEFMDP ELCNILLSDG       780
     IPRAMN                                                                  786
//

If you have problems or comments...

PBIL Back to PBIL home page