(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE201

PENCW_10.PE201       Location/Qualifiers
FT   CDS             join(complement(468008..468200),complement(467635..467952),
FT                   complement(466749..467578),complement(466612..466684),
FT                   complement(465931..466562))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000225953" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949820"
FT                   /orf_name="Pc13g02010"
FT                   /product="Pc13g02010 protein"
FT                   /function="transketolase activity"
FT                   /protein_id="CAP91270.1"
FT                   /db_xref="GO:0004802"
FT                   /db_xref="InterPro:IPR005474"
FT                   /db_xref="InterPro:IPR005475"
FT                   /db_xref="InterPro:IPR005476"
FT                   /db_xref="InterPro:IPR005478"
FT                   /db_xref="InterPro:IPR009014"
FT                   /db_xref="InterPro:IPR015941"
FT                   /db_xref="InterPro:IPR020826"
FT                   /db_xref="UniParc:UPI0001830910"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C1"
FT                   /transl_table=1
FT                   /translation="MPDDEHAVLTLRNLIFDICNQNGGGHGGSAVGMAAIGVALWKHIM
FT                   RYNPSNPDWFDRDRFVLSNGHCAMFLYALNYLTGFNAWTMNELKGYGGGKENGFTTIAH
FT                   GHPEIECPGIEVTTGPLGQGIANSVGLAIASKNLAARFNRPGYEVVSSRVYCMTGDGCL
FT                   MEGVALEAISLAGHLQLDNLVLVYDNNGVTCDGPLSWINTEDINQKMRASGWHVLDVMD
FT                   GCDNVQAICSSLRRAQSLKGKPTFINIRTVIGVGTTTAGTAKAHHGSFDVESVAKSKLA
FT                   IGQDPYQSHKPTARGLDYFRERKQHGEALEKSWQHLLMQYTLDFPDLASDFASRLRGAK
FT                   PDLGSLLQDLDSSQFSQMPTRESNGLILQKLWETCPSFCGGGADLVNSNKFFYSDTDVF
FT                   HPSVSYQGRYIRYGIREHAMASISNGLAAYHPGTFLPVTATFLMFYIYAAPGVRMGALS
FT                   HLPTIHIATHDSFAEGQNGPTHQPVELDSLYRAMPNLTYIRPSDAEEVIGAWMWAVESA
FT                   SSPTMISVGRDPVDQPAITSRFNVSKGAYVLEEHPDAQLTLVSCGTSLHYAIRAANELS
FT                   EQLSIRCRIVSAPSFDLFDQQPAEYRESVFPLDGNPIISVEEYVATTWARYVTASVGMT
FT                   SYGYSASNPSNYERFGLDTRGIVLRVKRYLAFLNGRSARQMGWRSI"
     MPDDEHAVLT LRNLIFDICN QNGGGHGGSA VGMAAIGVAL WKHIMRYNPS NPDWFDRDRF        60
     VLSNGHCAMF LYALNYLTGF NAWTMNELKG YGGGKENGFT TIAHGHPEIE CPGIEVTTGP       120
     LGQGIANSVG LAIASKNLAA RFNRPGYEVV SSRVYCMTGD GCLMEGVALE AISLAGHLQL       180
     DNLVLVYDNN GVTCDGPLSW INTEDINQKM RASGWHVLDV MDGCDNVQAI CSSLRRAQSL       240
     KGKPTFINIR TVIGVGTTTA GTAKAHHGSF DVESVAKSKL AIGQDPYQSH KPTARGLDYF       300
     RERKQHGEAL EKSWQHLLMQ YTLDFPDLAS DFASRLRGAK PDLGSLLQDL DSSQFSQMPT       360
     RESNGLILQK LWETCPSFCG GGADLVNSNK FFYSDTDVFH PSVSYQGRYI RYGIREHAMA       420
     SISNGLAAYH PGTFLPVTAT FLMFYIYAAP GVRMGALSHL PTIHIATHDS FAEGQNGPTH       480
     QPVELDSLYR AMPNLTYIRP SDAEEVIGAW MWAVESASSP TMISVGRDPV DQPAITSRFN       540
     VSKGAYVLEE HPDAQLTLVS CGTSLHYAIR AANELSEQLS IRCRIVSAPS FDLFDQQPAE       600
     YRESVFPLDG NPIISVEEYV ATTWARYVTA SVGMTSYGYS ASNPSNYERF GLDTRGIVLR       660
     VKRYLAFLNG RSARQMGWRS I                                                 681
//

If you have problems or comments...

PBIL Back to PBIL home page