(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE203

PENCW_10.PE203       Location/Qualifiers
FT   CDS             join(470395..470499,470553..470611,470667..470761,
FT                   470830..471113,471176..471283,471353..471584,
FT                   471637..471934,471983..472490)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000204544" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672163"
FT                   /orf_name="Pc13g02030"
FT                   /product="Pc13g02030 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91272.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI00018309E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C3"
FT                   /transl_table=1
FT                   /translation="MASSYAPTAIIIGAGPGGISMAYRLKHELGFNDFLIYEKLDGVGG
FT                   TWRSNTYPGCGCDLPSHLYSFSFNLNANWSKELCEQPEILQYIEDTVDKFDLRQHVVTS
FT                   VECLGGAWNPDEKEWTVKFRDVETGLEFERHATVFVSAVGAISFPRDVRFKGMENFKGD
FT                   MFHTARWDHSVDYTGKRVAVIGNGCSAAQVVPAVSGKAAFVQQYARSAQWYHPRPNKSF
FT                   SQLEKWSFRWLPLWQRWLRLRIFLTAEQEAYTYFSSEAGIKARLAAEDESREYILSRTP
FT                   QQYKKAVVPDFPLGCKRRIFDPGYLDSLHQSNVKLCNEGIQEFTENGIIGSSGIEDEFD
FT                   IVVLATGFQVSQFLAPMEIYGRHGVSLNKQWSESRGAQAYYGTFVHNFPNLAIIFGPNT
FT                   FPANNSALFACETQVCFAVKALFEPILDRRARVVEVKQSAEERHTISLQEQLKGTVFAG
FT                   DCSNWYINEFGRNAASWPARAAFLWLETFWPNWKAFLWKDGSATWPLYRLARWWKMGSW
FT                   CSKASIAAIVAIFLSHNRAGSTLGVTGAFETLHERIRALTCYLAI"
     MASSYAPTAI IIGAGPGGIS MAYRLKHELG FNDFLIYEKL DGVGGTWRSN TYPGCGCDLP        60
     SHLYSFSFNL NANWSKELCE QPEILQYIED TVDKFDLRQH VVTSVECLGG AWNPDEKEWT       120
     VKFRDVETGL EFERHATVFV SAVGAISFPR DVRFKGMENF KGDMFHTARW DHSVDYTGKR       180
     VAVIGNGCSA AQVVPAVSGK AAFVQQYARS AQWYHPRPNK SFSQLEKWSF RWLPLWQRWL       240
     RLRIFLTAEQ EAYTYFSSEA GIKARLAAED ESREYILSRT PQQYKKAVVP DFPLGCKRRI       300
     FDPGYLDSLH QSNVKLCNEG IQEFTENGII GSSGIEDEFD IVVLATGFQV SQFLAPMEIY       360
     GRHGVSLNKQ WSESRGAQAY YGTFVHNFPN LAIIFGPNTF PANNSALFAC ETQVCFAVKA       420
     LFEPILDRRA RVVEVKQSAE ERHTISLQEQ LKGTVFAGDC SNWYINEFGR NAASWPARAA       480
     FLWLETFWPN WKAFLWKDGS ATWPLYRLAR WWKMGSWCSK ASIAAIVAIF LSHNRAGSTL       540
     GVTGAFETLH ERIRALTCYL AI                                                562
//

If you have problems or comments...

PBIL Back to PBIL home page