(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE204

PENCW_10.PE204       Location/Qualifiers
FT   CDS             join(472872..473198,473252..473992)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000227439" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978064"
FT                   /orf_name="Pc13g02040"
FT                   /product="Pc13g02040 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91273.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR000683"
FT                   /db_xref="InterPro:IPR004104"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018309E3"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C4"
FT                   /transl_table=1
FT                   /translation="MTKVKANIGVVGLGRMGQRHALNILHQVPRAKLFAVCTPASHEIE
FT                   WAKAKLVPDGVLVFQSFEEMIHTPGLDAVVIASPTELHIAQTLTAMQLEIHVLCEKPIT
FT                   RDIPQLRDLMETAKQHPQTKVMVGFVRRFDENYMDAIQKIKSGAIGEPLIVRSQGAEKL
FT                   DKSGFFIEYARQSGGIFVDTVVHDIDLTLSILGEEVRPKALWATGIIAHHHEMKDFKDV
FT                   DNSVGVVEFWGGRIAHYYHSRTTSHGYDNCTDIIGMNGKISINSVPHSNRVQVSNASGI
FT                   MQDCTPSWIDRYREAFVTEVNQFTDAILDNTELPMRLSAAYTGLKIATAFQESLETGRK
FT                   IEFDENGDRIVSNGK"
     MTKVKANIGV VGLGRMGQRH ALNILHQVPR AKLFAVCTPA SHEIEWAKAK LVPDGVLVFQ        60
     SFEEMIHTPG LDAVVIASPT ELHIAQTLTA MQLEIHVLCE KPITRDIPQL RDLMETAKQH       120
     PQTKVMVGFV RRFDENYMDA IQKIKSGAIG EPLIVRSQGA EKLDKSGFFI EYARQSGGIF       180
     VDTVVHDIDL TLSILGEEVR PKALWATGII AHHHEMKDFK DVDNSVGVVE FWGGRIAHYY       240
     HSRTTSHGYD NCTDIIGMNG KISINSVPHS NRVQVSNASG IMQDCTPSWI DRYREAFVTE       300
     VNQFTDAILD NTELPMRLSA AYTGLKIATA FQESLETGRK IEFDENGDRI VSNGK            355
//

If you have problems or comments...

PBIL Back to PBIL home page