(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE205

PENCW_10.PE205       Location/Qualifiers
FT   CDS             join(complement(475405..475471),complement(475207..475351),
FT                   complement(475078..475155),complement(474932..475013),
FT                   complement(474660..474883),complement(474394..474610))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15949822"
FT                   /orf_name="Pc13g02050"
FT                   /product="Pc13g02050 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP91274.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI00018309E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C5"
FT                   /transl_table=1
FT                   /translation="MANLASSLAARFSLGGRVILITGGGRGIGMALSKTCLDAGATVVV
FT                   TDVLPQPDPVFLDWRKSTPDQLHYYCCDLTNKEEVGRTFTSILEKFHHIHGVVTAAGIC
FT                   IDKPFLKHEWEDIQNLQAVNETGTFFAVQNVVKNMKQYGIKGSIVMICSQSAQHVCPGH
FT                   LLTAYAGSKGFVFSMARSLAHELAPDGIRVNTVSPGYIATDMNLSLASLRPELLKIFCE
FT                   APPLRRVGTPQDVELAVLYLLSGGSSYVTGQDLAIDGGMQVSSGNYKL"
     MANLASSLAA RFSLGGRVIL ITGGGRGIGM ALSKTCLDAG ATVVVTDVLP QPDPVFLDWR        60
     KSTPDQLHYY CCDLTNKEEV GRTFTSILEK FHHIHGVVTA AGICIDKPFL KHEWEDIQNL       120
     QAVNETGTFF AVQNVVKNMK QYGIKGSIVM ICSQSAQHVC PGHLLTAYAG SKGFVFSMAR       180
     SLAHELAPDG IRVNTVSPGY IATDMNLSLA SLRPELLKIF CEAPPLRRVG TPQDVELAVL       240
     YLLSGGSSYV TGQDLAIDGG MQVSSGNYKL                                        270
//

If you have problems or comments...

PBIL Back to PBIL home page