(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE206

PENCW_10.PE206       Location/Qualifiers
FT   CDS             join(complement(476694..476973),complement(475746..476632))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949823"
FT                   /orf_name="Pc13g02060"
FT                   /product="Pc13g02060 protein"
FT                   /function="binding"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91275.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018309E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C6"
FT                   /transl_table=1
FT                   /translation="MTQTGKHALIFGASGISGWSLLNQTLQYPTPTTFNRVTGLCNRPW
FT                   ISEDAYLPDDNRLNIVSGIDLTQSVEAVKAQLKEKVAKVESVDVVFFCAYIQTGDFQSL
FT                   RKVNTDLLQTAIKAISAVSPTMEAVILQTGGKGYGLEFPKEVTIQPPLHEKMPRIPSPW
FT                   RENVFYYDQYDLLKRLSEDQNWTFTEIRPDGIVGFAPGSNVMNMAYGIAFYLTLYREVN
FT                   GKDAKVPFPGRLHGYHTRHTDTFQDILSKMEIFAALNRGKCQNGSSFNCGDGEAVTWAQ
FT                   VWPGICSYFGLNGVEPDGMQKNMQDFVSENKAIWDRLVLTHDLKKGLIESQNWGHTNFM
FT                   LVDFDFAREYSLEAARSVGFNEQIDTLQGYHVTFDRMVNARFIPVPSS"
     MTQTGKHALI FGASGISGWS LLNQTLQYPT PTTFNRVTGL CNRPWISEDA YLPDDNRLNI        60
     VSGIDLTQSV EAVKAQLKEK VAKVESVDVV FFCAYIQTGD FQSLRKVNTD LLQTAIKAIS       120
     AVSPTMEAVI LQTGGKGYGL EFPKEVTIQP PLHEKMPRIP SPWRENVFYY DQYDLLKRLS       180
     EDQNWTFTEI RPDGIVGFAP GSNVMNMAYG IAFYLTLYRE VNGKDAKVPF PGRLHGYHTR       240
     HTDTFQDILS KMEIFAALNR GKCQNGSSFN CGDGEAVTWA QVWPGICSYF GLNGVEPDGM       300
     QKNMQDFVSE NKAIWDRLVL THDLKKGLIE SQNWGHTNFM LVDFDFAREY SLEAARSVGF       360
     NEQIDTLQGY HVTFDRMVNA RFIPVPSS                                          388
//

If you have problems or comments...

PBIL Back to PBIL home page