(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE207

PENCW_10.PE207       Location/Qualifiers
FT   CDS             join(478622..478821,478879..479223,479283..479481)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000202856" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824871"
FT                   /orf_name="Pc13g02070"
FT                   /product="Pc13g02070 protein"
FT                   /protein_id="CAP91276.1"
FT                   /db_xref="UniParc:UPI00018309E6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C7"
FT                   /transl_table=1
FT                   /translation="MSDFWLTEHIRHLVVQPADARLNPPEGYLFVQDGFIISCGVIYAL
FT                   LYVFVMIRAVKDRVLPGTIKYLSLTLAYELYYAFATTSTRLERICFLAWFELDLTFVAL
FT                   ALWRVYRPDQRKRIAGEMFIYCITALAGLRYLGYLYPDDREQITAYWTGILLQLPVGWV
FT                   YVYGLVKHRSLLGHSLEIWLLRYLGCFTAYGLFIWRYLNVPRNWEYVGSFWSIATIVTT
FT                   LIPETVYPFLYIWVFNQNRNKVKMG"
     MSDFWLTEHI RHLVVQPADA RLNPPEGYLF VQDGFIISCG VIYALLYVFV MIRAVKDRVL        60
     PGTIKYLSLT LAYELYYAFA TTSTRLERIC FLAWFELDLT FVALALWRVY RPDQRKRIAG       120
     EMFIYCITAL AGLRYLGYLY PDDREQITAY WTGILLQLPV GWVYVYGLVK HRSLLGHSLE       180
     IWLLRYLGCF TAYGLFIWRY LNVPRNWEYV GSFWSIATIV TTLIPETVYP FLYIWVFNQN       240
     RNKVKMG                                                                 247
//

If you have problems or comments...

PBIL Back to PBIL home page