(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE208

PENCW_10.PE208       Location/Qualifiers
FT   CDS             join(480553..480791,480978..481170)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129229"
FT                   /orf_name="Pc13g02080"
FT                   /product="Putative uncharacterized protein Pc13g02080 "
FT                   /protein_id="CAP91277.1"
FT                   /db_xref="UniParc:UPI00018309E7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1C8"
FT                   /transl_table=1
FT                   /translation="MPSTTPKDLTMQTRDFHLPPARAPPSLQPLHHLSQRLLPNPSDLI
FT                   VHGAISAFNNEALLSPSPKQTWLQTGEDANSLIARSIKGPGESAEIVFLVTKNGTWMQY
FT                   NPNYAGNVSHALRIVAMTAFQEQRRLSTCSVSATRNSWR"
     MPSTTPKDLT MQTRDFHLPP ARAPPSLQPL HHLSQRLLPN PSDLIVHGAI SAFNNEALLS        60
     PSPKQTWLQT GEDANSLIAR SIKGPGESAE IVFLVTKNGT WMQYNPNYAG NVSHALRIVA       120
     MTAFQEQRRL STCSVSATRN SWR                                               143
//

If you have problems or comments...

PBIL Back to PBIL home page