(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE211

PENCW_10.PE211       Location/Qualifiers
FT   CDS             join(complement(485581..485714),complement(485406..485532),
FT                   complement(485337..485349),complement(484774..485273))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672164"
FT                   /orf_name="Pc13g02110"
FT                   /product="Pc13g02110 protein"
FT                   /protein_id="CAP91280.1"
FT                   /db_xref="InterPro:IPR011333"
FT                   /db_xref="InterPro:IPR013069"
FT                   /db_xref="UniParc:UPI00018309E9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1D0"
FT                   /transl_table=1
FT                   /translation="MPKKKGCAAKIVKKPSWIPVSPDLSRDRVIQNNLPGKELLYALAS
FT                   LRLHSKYSDISLTCGNTIYTVYKCIVCTRSEFFAKACSSGFKESSIDYRVKGCLSGSSH
FT                   DILEETSTVNDSGSPTVFTAKPIPYIAESGADEDSLGRPVEPIEDLIAEIDPLSFHILI
FT                   YSLADRMFIVGLEAISKAKVERELLRRLDANTFQSAIVEIYNSTPASDRGLRDLAVEIT
FT                   LYHLRELRTSKERADFAFPSWRDPCHNLRLICLPQ"
     MPKKKGCAAK IVKKPSWIPV SPDLSRDRVI QNNLPGKELL YALASLRLHS KYSDISLTCG        60
     NTIYTVYKCI VCTRSEFFAK ACSSGFKESS IDYRVKGCLS GSSHDILEET STVNDSGSPT       120
     VFTAKPIPYI AESGADEDSL GRPVEPIEDL IAEIDPLSFH ILIYSLADRM FIVGLEAISK       180
     AKVERELLRR LDANTFQSAI VEIYNSTPAS DRGLRDLAVE ITLYHLRELR TSKERADFAF       240
     PSWRDPCHNL RLICLPQ                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page