(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE212

PENCW_10.PE212       Location/Qualifiers
FT   CDS             486089..486868
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000333" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949825"
FT                   /orf_name="Pc13g02120"
FT                   /product="Pc13g02120 protein"
FT                   /protein_id="CAP91281.1"
FT                   /db_xref="InterPro:IPR021139"
FT                   /db_xref="UniParc:UPI00018309EA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I0"
FT                   /transl_table=1
FT                   /translation="MAGDTIPKLAVLIDADNARPSVVNLLLSEIAKYGTAHAKRAHGDW
FT                   TRSSLQGWKDVLLEQSIQPIQQFAYTHGKNATDSAMIIDAMDLLYSNRYDGFCLVSSDS
FT                   DFTRLAARIRESGLIVYGFGEQKTPKPFVAACDKFIYTENLVHLDELVPHTNSVMIPGN
FT                   HVPTLQAQNDSRLRNQLRTTVEAASDDDGWARLSSVGQLLTKKYPDFDSRSYGYHKLSD
FT                   LIAASSWFETTRRSLRNGLSPEIFVRDKRRKSKALAD"
     MAGDTIPKLA VLIDADNARP SVVNLLLSEI AKYGTAHAKR AHGDWTRSSL QGWKDVLLEQ        60
     SIQPIQQFAY THGKNATDSA MIIDAMDLLY SNRYDGFCLV SSDSDFTRLA ARIRESGLIV       120
     YGFGEQKTPK PFVAACDKFI YTENLVHLDE LVPHTNSVMI PGNHVPTLQA QNDSRLRNQL       180
     RTTVEAASDD DGWARLSSVG QLLTKKYPDF DSRSYGYHKL SDLIAASSWF ETTRRSLRNG       240
     LSPEIFVRDK RRKSKALAD                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page