(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE213

PENCW_10.PE213       Location/Qualifiers
FT   CDS             join(488391..488465,488526..488550,488620..488826,
FT                   488925..489012,489151..489451,489538..489808,
FT                   489916..490672,490726..490975)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949826"
FT                   /orf_name="Pc13g02130"
FT                   /product="Pc13g02130 protein"
FT                   /protein_id="CAP91282.1"
FT                   /db_xref="InterPro:IPR014870"
FT                   /db_xref="UniParc:UPI00018309EB"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I1"
FT                   /transl_table=1
FT                   /translation="MWPLSPLLLLSLAAGSFVRLSSYPLAVKTPYLPAWLPGDQAKNVS
FT                   TARPEFWAGQPLTWKVITRVNGEVYSLFGCPDENITSVDQISISYSATHTVVTLKTGNN
FT                   NNIEGEVDVMTAIDESWSAQPGQMVMGCAAPSTILSQFPLFGQVSRNISNYTRDDLVAF
FT                   AYRFGCRNVVQTSSVTFAIGLQQDLNGFFGEVYESLYFEPLWSTTEEVVDHFLEDEACA
FT                   REESKKLDQQLIIFCSWLISSSWGLIHISVPWCSKDTSYHLGFMKAISASGRVSPISGL
FT                   LPSALPAFYVLAPDYIPLLLKPVLNMTLGWPMDYALHDIGKHYPNATGPTENDEYTFPL
FT                   QQTSTLLWMVYAYQKPSGDIEWAKPFLPALHRYADYLVRHGQYPPEERSTIDHNESRAN
FT                   QTLIAISASIGLKAYGALSGMANYTDIGNLYASTIMDLGTDTKQAHFTSHYGRADSSWI
FT                   TSYPLAYDKLLGLDTFDEAVYEMQSTWYKDLIQPDGLQFSSDVQFTVADLEMMAAATCS
FT                   NDVQALIVDSLHQTTTSRIDSVPGPTRWNVTGANSGRQSSTKAQAAVGGYWMLAAVNMS
FT                   GQGVPVELPSELWLTQDIYQVPLKPSQVSLTKVRIPELIAQGHKGQTQKNGTAVRPGAQ
FT                   QPEGSKDIQEVVTASKLIHIDL"
     MWPLSPLLLL SLAAGSFVRL SSYPLAVKTP YLPAWLPGDQ AKNVSTARPE FWAGQPLTWK        60
     VITRVNGEVY SLFGCPDENI TSVDQISISY SATHTVVTLK TGNNNNIEGE VDVMTAIDES       120
     WSAQPGQMVM GCAAPSTILS QFPLFGQVSR NISNYTRDDL VAFAYRFGCR NVVQTSSVTF       180
     AIGLQQDLNG FFGEVYESLY FEPLWSTTEE VVDHFLEDEA CAREESKKLD QQLIIFCSWL       240
     ISSSWGLIHI SVPWCSKDTS YHLGFMKAIS ASGRVSPISG LLPSALPAFY VLAPDYIPLL       300
     LKPVLNMTLG WPMDYALHDI GKHYPNATGP TENDEYTFPL QQTSTLLWMV YAYQKPSGDI       360
     EWAKPFLPAL HRYADYLVRH GQYPPEERST IDHNESRANQ TLIAISASIG LKAYGALSGM       420
     ANYTDIGNLY ASTIMDLGTD TKQAHFTSHY GRADSSWITS YPLAYDKLLG LDTFDEAVYE       480
     MQSTWYKDLI QPDGLQFSSD VQFTVADLEM MAAATCSNDV QALIVDSLHQ TTTSRIDSVP       540
     GPTRWNVTGA NSGRQSSTKA QAAVGGYWML AAVNMSGQGV PVELPSELWL TQDIYQVPLK       600
     PSQVSLTKVR IPELIAQGHK GQTQKNGTAV RPGAQQPEGS KDIQEVVTAS KLIHIDL          657
//

If you have problems or comments...

PBIL Back to PBIL home page