(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE214

PENCW_10.PE214       Location/Qualifiers
FT   CDS             join(complement(492493..493149),complement(492423..492448),
FT                   complement(491427..492373),complement(491195..491359))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000000000" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949827"
FT                   /orf_name="Pc13g02140"
FT                   /product="Pc13g02140 protein"
FT                   /function="RNA binding"
FT                   /function="RNA-directed DNA polymerase activity "
FT                   /biological_process="RNA-dependent DNA replication "
FT                   /protein_id="CAP91283.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003964"
FT                   /db_xref="GO:0006278"
FT                   /db_xref="InterPro:IPR000477"
FT                   /db_xref="UniParc:UPI00018309EC"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I2"
FT                   /transl_table=1
FT                   /translation="EVRKKRNPIGGIEIFTTSLSEIDRILTIKSSIEEDLKLREIKKIL
FT                   PLEYHDLAEVFSKKKLDKLPLYRPGVDHDIILKAEAXPGYYPLYKLSLNKLKAAKXYII
FT                   KNLDKGFIILSASPYISLILIVKKPSGRLRFYINFRKLNIITKKDYYPLPLIDKVLXRT
FT                   SKAKYFTKLNIRXGFYRIRLTLGAEDLTTFRTRYGSFKYKVILFGLTNGPAIFXRFINN
FT                   ILREYIDKYIVTFI"
     MSKALGLARV SSSINPKNIV NNRAPLARAN VPNAAVDNAN AAPARAPSGS SEQATESPRL        60
     SSANIAWTMM SLCLSVLLSA LDLTIVTPAI PAIVGSFQSA AGYTWVGGAY TLAYAAVTPV       120
     WGSVSDIWGR KPIMLIAVAI FLVGSLVCAL APKMNALIVG RAIQGLGGSG MGIMVNIVVS       180
     DMFSLRDRGL YLAITSLVWA VGSAIGPVLG GVFTEKLRQL AMVFLDQSTG RGRLLSRLTI       240
     LQESPKPPNS DRRRSKSHRL DRKRSNCRGC SDGPPGPRVW RRRLLLVFRN SDLPINFRHS       300
     SDGPVCGQXV EDCQEPYYPS LAICLAEQGS AVRCLCVQLI CLHRAGILPT PVRAVCPSRN       360
     SLDVRTVPAS ANRLMRPGRS RSGDFHAANW EISARDVYCA GLFGPWLGTA NQSQIXIQHN       420
     XTSHLPDSGR DRRGHEHRSP YPGGSSCCRC SXYGCCDCDN GVCPVPFHRY LSCRRWRGLS       480
     EXDECEERGV GKPARFGFIS SQHIQWRQCC FECGEDXHRW TECRSTSLGX EDVLXGVEDG       540
     VGHVCCLCRI SHHSXSICAG PXAPEXKXGR RAGRXSVTAR RQPYQWGHGN GVEXSTXL         598
//

If you have problems or comments...

PBIL Back to PBIL home page