(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE217

PENCW_10.PE217       Location/Qualifiers
FT   CDS             495404..498367
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210305" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949828"
FT                   /orf_name="Pc13g02170"
FT                   /product="Pc13g02170 protein"
FT                   /function="peptidase activity"
FT                   /biological_process="proteolysis"
FT                   /protein_id="CAP91286.1"
FT                   /db_xref="GO:0006508"
FT                   /db_xref="GO:0008233"
FT                   /db_xref="InterPro:IPR007484"
FT                   /db_xref="UniParc:UPI00018309ED"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I3"
FT                   /transl_table=1
FT                   /translation="MATRKARNPLAFMPWPVTILTTAMYLALIIPLLVIHHNVPPAPRT
FT                   SPNGLNLTEAWQDLQSLTKGFHPYNSHQNDEVRSWLLERIDAIKQSTPSTEEYRDAKEE
FT                   KPDVFVFDDLVSNLTFIDKSVGVYFEGTNILVYIRGSEDNKQNWWETPGRAPVGKGGVL
FT                   VNAHYDSVSTGYGATDDGVGVVTCLQLVKYFLTPGHAPRRGLVVLFNNGEEDYLNGARV
FT                   YSQHPMARFAHTFLNLEGAGAGGRATLFRSSDTEVTQAYAKSEHPFGSVLSANGFEKGL
FT                   ISSQTDYVVLEGILGLRGLDVAFFEPRARYHTDQDDARHTSIDSLWHMLSTAVATTEEL
FT                   VSDTTDRFDGHIRDDGTVPSGSGTRAVWFDLFGSAFAVFRLHTLFALSVTLLIVAPLTL
FT                   LVTSVILSRADKMYLFRSSVYSEINDDYIPLRGLRGFFRFPFLISIPTGVTVGLAYMVT
FT                   KVNPFIAHSSSYAVWSMMISAWIFLAWFVSRVANSARPSAFHRVYTWTWMFVLTWSLMV
FT                   VCTVYEHEEGLAGGYFIFFYFAGTFLATWISYLELFALPTKSEYVGRLAESRRPSTQGS
FT                   RLAASGDEHQDDAAEEDPTESTSLLHGRHRPTFANYVRVGVDRASQDEEEEEEDPNVYE
FT                   HEQGWSGVLPRWTWLLQLLITAPVILMLIVPLALLTTSALSQTGQDGSPQLLIYLFISC
FT                   LTALLFAPMLPFIHRYTYHLPIFLLFVFIGTMIYNLVAFPFADSNRLKLFFLQEVDLDN
FT                   GISTASLTGMPPFVSDVTYGLPSAAGQNESCDWTFRGKRKLQRCSWSAPLPHVVPDGDS
FT                   LSVSSEDADSLLDATELSPDWISFSISHPQRDSSSVRFEVSGQNTRNCRINMDGNSITN
FT                   FSVIGSSAPDHRFLNPSPDGLNRIQLWSRTWDNKWTVDVDFSKHDSSETDEVDESSITG
FT                   RITCLWSDNNRVGLIPALDEVRQFSPAWVAVTKFSDGLIEGSRAFEIKRSSLGALGS"
     MATRKARNPL AFMPWPVTIL TTAMYLALII PLLVIHHNVP PAPRTSPNGL NLTEAWQDLQ        60
     SLTKGFHPYN SHQNDEVRSW LLERIDAIKQ STPSTEEYRD AKEEKPDVFV FDDLVSNLTF       120
     IDKSVGVYFE GTNILVYIRG SEDNKQNWWE TPGRAPVGKG GVLVNAHYDS VSTGYGATDD       180
     GVGVVTCLQL VKYFLTPGHA PRRGLVVLFN NGEEDYLNGA RVYSQHPMAR FAHTFLNLEG       240
     AGAGGRATLF RSSDTEVTQA YAKSEHPFGS VLSANGFEKG LISSQTDYVV LEGILGLRGL       300
     DVAFFEPRAR YHTDQDDARH TSIDSLWHML STAVATTEEL VSDTTDRFDG HIRDDGTVPS       360
     GSGTRAVWFD LFGSAFAVFR LHTLFALSVT LLIVAPLTLL VTSVILSRAD KMYLFRSSVY       420
     SEINDDYIPL RGLRGFFRFP FLISIPTGVT VGLAYMVTKV NPFIAHSSSY AVWSMMISAW       480
     IFLAWFVSRV ANSARPSAFH RVYTWTWMFV LTWSLMVVCT VYEHEEGLAG GYFIFFYFAG       540
     TFLATWISYL ELFALPTKSE YVGRLAESRR PSTQGSRLAA SGDEHQDDAA EEDPTESTSL       600
     LHGRHRPTFA NYVRVGVDRA SQDEEEEEED PNVYEHEQGW SGVLPRWTWL LQLLITAPVI       660
     LMLIVPLALL TTSALSQTGQ DGSPQLLIYL FISCLTALLF APMLPFIHRY TYHLPIFLLF       720
     VFIGTMIYNL VAFPFADSNR LKLFFLQEVD LDNGISTASL TGMPPFVSDV TYGLPSAAGQ       780
     NESCDWTFRG KRKLQRCSWS APLPHVVPDG DSLSVSSEDA DSLLDATELS PDWISFSISH       840
     PQRDSSSVRF EVSGQNTRNC RINMDGNSIT NFSVIGSSAP DHRFLNPSPD GLNRIQLWSR       900
     TWDNKWTVDV DFSKHDSSET DEVDESSITG RITCLWSDNN RVGLIPALDE VRQFSPAWVA       960
     VTKFSDGLIE GSRAFEIKRS SLGALGS                                           987
//

If you have problems or comments...

PBIL Back to PBIL home page