(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE218

PENCW_10.PE218       Location/Qualifiers
FT   CDS             complement(499214..500314)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000171725" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672165"
FT                   /orf_name="Pc13g02180"
FT                   /product="Pc13g02180 protein"
FT                   /protein_id="CAP91287.1"
FT                   /db_xref="UniParc:UPI00018309EE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I4"
FT                   /transl_table=1
FT                   /translation="MGDFTAPGNGISGHYQGTSLGMKITIATLAGVTWYNAFELMILLF
FT                   VTFAEYRGLYFWSLFISSSVGLLPYSLGFLLKFFKITDDIAWFPVTLLTIGWWSMVTGQ
FT                   SIVLYSRLHLVVSNQRVLRRVLIMIVVNAIILHLPTTALTYGTNMADDTTLWTKTYNIM
FT                   EKIQMTGFCIQEFIISGLYIWETVRMLRLDPDRIKRKIQYQLLAINLIIIILDLGLLVA
FT                   EYLDFYIMETMLKGVVYSIKLKLEFAVLGKLIHLVHNHVWKPESFSAPRDLPDFVDATR
FT                   VTSDMTHATHSAIQRRPSRMDADDISIAMFEHLPPDRIRTNSDLSHSWSNEGRAYHVDH
FT                   LPIDFTNPFAHYPRYQSRRGIPEKPG"
     MGDFTAPGNG ISGHYQGTSL GMKITIATLA GVTWYNAFEL MILLFVTFAE YRGLYFWSLF        60
     ISSSVGLLPY SLGFLLKFFK ITDDIAWFPV TLLTIGWWSM VTGQSIVLYS RLHLVVSNQR       120
     VLRRVLIMIV VNAIILHLPT TALTYGTNMA DDTTLWTKTY NIMEKIQMTG FCIQEFIISG       180
     LYIWETVRML RLDPDRIKRK IQYQLLAINL IIIILDLGLL VAEYLDFYIM ETMLKGVVYS       240
     IKLKLEFAVL GKLIHLVHNH VWKPESFSAP RDLPDFVDAT RVTSDMTHAT HSAIQRRPSR       300
     MDADDISIAM FEHLPPDRIR TNSDLSHSWS NEGRAYHVDH LPIDFTNPFA HYPRYQSRRG       360
     IPEKPG                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page