(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE219

PENCW_10.PE219       Location/Qualifiers
FT   CDS             complement(501217..502122)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000250265" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949829"
FT                   /orf_name="Pc13g02190"
FT                   /product="Pc13g02190 protein"
FT                   /function="catalytic activity"
FT                   /function="coenzyme binding"
FT                   /biological_process="cellular metabolic process "
FT                   /protein_id="CAP91288.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="GO:0044237"
FT                   /db_xref="GO:0050662"
FT                   /db_xref="InterPro:IPR001509"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="UniParc:UPI00018309EF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I5"
FT                   /transl_table=1
FT                   /translation="MGKRIVITGGSGKAGQHIIRYLLQQGHDLLNLDLVPLPAELEERV
FT                   HTLRVDLTNTGQVYSALGSHFHLSEPFREPLGLVPDAVIHMAGYSRNMIVPDEETFRSN
FT                   TSAMYNIIEGASRLGIKKIIIASSITVYGVSYAEGDVDYPSFPVDETVDANPMDTYAIS
FT                   KVCGESIARGFARRYGRDIYILRIGRIVAPEEYKQSMFRSYVENPEKWAPHGWAYIDAR
FT                   DLGQMCDRAVQKDGLGFQIFNAVNDGITNYENTAEFLARVCPGVPVTRELGAREAPICN
FT                   RKIKELLGFREEHHWMKYYE"
     MGKRIVITGG SGKAGQHIIR YLLQQGHDLL NLDLVPLPAE LEERVHTLRV DLTNTGQVYS        60
     ALGSHFHLSE PFREPLGLVP DAVIHMAGYS RNMIVPDEET FRSNTSAMYN IIEGASRLGI       120
     KKIIIASSIT VYGVSYAEGD VDYPSFPVDE TVDANPMDTY AISKVCGESI ARGFARRYGR       180
     DIYILRIGRI VAPEEYKQSM FRSYVENPEK WAPHGWAYID ARDLGQMCDR AVQKDGLGFQ       240
     IFNAVNDGIT NYENTAEFLA RVCPGVPVTR ELGAREAPIC NRKIKELLGF REEHHWMKYY       300
     E                                                                       301
//

If you have problems or comments...

PBIL Back to PBIL home page