(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE22

PENCW_10.PE22        Location/Qualifiers
FT   CDS             join(49646..50001,50063..50288,50464..50754,50811..51039,
FT                   51092..51251,51314..55217)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076558" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948689"
FT                   /orf_name="Pc13g00220"
FT                   /product="Pc13g00220 protein"
FT                   /function="binding"
FT                   /function="microtubule motor activity"
FT                   /cellular_component="kinesin complex"
FT                   /protein_id="CAP91091.1"
FT                   /db_xref="GO:0003777"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005871"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR002151"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001830DBE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H5"
FT                   /transl_table=1
FT                   /translation="MASQRKSHVFRVTGLSRELPDRDLKTAVQRALNDNFTDDERSHIT
FT                   AEVTIVPSCYESDTERAALVQFRGGVPQFLYELRVDPLGDWQVEMGDNDINFDCHFFGF
FT                   TQLYAPDDNEPVVADIIAIAGLDGHAYGSWQGRGNLGRMWLRDFLSKDLPQCRTMIYGY
FT                   NSKLSSHGVDTILDYGRELMEEIKKIRNTKECLVRAIQTMEEDHPAITSLHRATYGMVL
FT                   FAIPHKGLVMDDIQQMLVGDKSHPRERLLQQISSKSDLLIHQLADFKNLIRDRKVVSFY
FT                   ETEQTRQLVLDSESGRWKRTGDFVTTVGADSALLQLPDHVEDKVPLHADHSMVVKFDTR
FT                   NAAGYRTAVDKLRQFLKDAPSVVAARFTQTRPKPQPCSTVPFKKDPMFVGRESVISAIN
FT                   ERHRAIGQRHERVALVGLAGVGKTQAAIEYSYRVRESTPDTWVFWIHASNTARLEQGYQ
FT                   QIATVAEIPGRDDPKINILQLVYQWLCDARNGRWLMVLDNADDDGIFFGDNTFNERGPL
FT                   VSFLPQAAHGSMLITSRNGLAARNLVGSDSHVITVQPMNEAESLALLRLRIPAPQSGES
FT                   GESGGDERALVQALECIPLAITQAAAYIANRLPLVTVSAYLRLFHESESKRTRLLQNED
FT                   SADLRRDPSIRYAVMTTWQLSFEQIRQERPAATDLLALMSMFDRQGIPEDLVRHHEQDI
FT                   LDFHDALAPLLSYSLIRLELNERLFDMHRLVQLSVRAWLDMHQQLYGWQAKSRGIMARV
FT                   FPDGEYESWSQCRSLLAHANSVLQSICDVDDKDRLNAAALLSNCGWFLDLQGVYEEAEA
FT                   MHRRALEAREKVLGREHPDTLTSVSNLGLVLSSQGKYDEAEAMHRRALEGYEEVLGREH
FT                   PNTLTSVNNLGSVLSRQGKYDEAEAMHRRDLEGSEKVLGREHPDTLTSVNNLGNVLSSQ
FT                   GKYDEAEAMHRRALEGCEEVLGREHPNTLTSVNNLGSVLSRQGKYDEAEAMHRRDLEGS
FT                   EKVLGREHPHTLASVNNLGNVLSSQGKYDEAEAMHRRALEGYEEVLGREHPNTLTSVNN
FT                   LGNVLSSQGKYDEAEAMHRRDLEGSEKVLGREHPDTLTSVSKLGNVLSSQGKYDEAEAM
FT                   HRRDLEGSEKVLGREHPDTFTSVSNLGLVLSSQGKYDEAEAMHRRALEGYEEVLGREHP
FT                   DTLTSVNNLGLVLSSQGKYDEAEAMHRRDLEGSEKVLGREHPDTFTSVNNLGDVLSRQG
FT                   KYDEAEAMHRRALEAREKVLGREHPDTLTSVSNLGGVLFSQGKYDEAEAMHRRALEARE
FT                   NVLGREHPNTLTSLSNLGNVLSSQGKYDEAEAMHRRALEARENVLGREHPDTLTSVNNL
FT                   GYILSSQGKYDEAEAMHRRALEGYEEVLGREHPNTLTSVNNLGDVLSRQGKYDEAEAMH
FT                   RRALEAREKVLGREHPDTLTSVSNLGDVLSSQGKYDEAEAMHRWALEAREKVLGREHPN
FT                   TLTSVSNFGDVLSSQGKYDEAEAMHRRALEAREKVLGREHPDTLTSVSKLGNVLSSQGK
FT                   YDEAEAMHRRALEAREKVLGREHPDTLTSVSKLGNVLSSQGKYDEAEAMHRRDLEGSEK
FT                   VLGREHPDTFTSVSNLANVLSNQGKYDEAEAIHLQDMEGSEKVLGREHPDTLTSVSKLG
FT                   NVLSNQGKYDEAEAIHLQDMEGSEKVLGREHPDTLTSVSKLGNVLSNQGKYDEAKAIHL
FT                   QDMEGSEKVLGCEHPRILASLNIR"
     MASQRKSHVF RVTGLSRELP DRDLKTAVQR ALNDNFTDDE RSHITAEVTI VPSCYESDTE        60
     RAALVQFRGG VPQFLYELRV DPLGDWQVEM GDNDINFDCH FFGFTQLYAP DDNEPVVADI       120
     IAIAGLDGHA YGSWQGRGNL GRMWLRDFLS KDLPQCRTMI YGYNSKLSSH GVDTILDYGR       180
     ELMEEIKKIR NTKECLVRAI QTMEEDHPAI TSLHRATYGM VLFAIPHKGL VMDDIQQMLV       240
     GDKSHPRERL LQQISSKSDL LIHQLADFKN LIRDRKVVSF YETEQTRQLV LDSESGRWKR       300
     TGDFVTTVGA DSALLQLPDH VEDKVPLHAD HSMVVKFDTR NAAGYRTAVD KLRQFLKDAP       360
     SVVAARFTQT RPKPQPCSTV PFKKDPMFVG RESVISAINE RHRAIGQRHE RVALVGLAGV       420
     GKTQAAIEYS YRVRESTPDT WVFWIHASNT ARLEQGYQQI ATVAEIPGRD DPKINILQLV       480
     YQWLCDARNG RWLMVLDNAD DDGIFFGDNT FNERGPLVSF LPQAAHGSML ITSRNGLAAR       540
     NLVGSDSHVI TVQPMNEAES LALLRLRIPA PQSGESGESG GDERALVQAL ECIPLAITQA       600
     AAYIANRLPL VTVSAYLRLF HESESKRTRL LQNEDSADLR RDPSIRYAVM TTWQLSFEQI       660
     RQERPAATDL LALMSMFDRQ GIPEDLVRHH EQDILDFHDA LAPLLSYSLI RLELNERLFD       720
     MHRLVQLSVR AWLDMHQQLY GWQAKSRGIM ARVFPDGEYE SWSQCRSLLA HANSVLQSIC       780
     DVDDKDRLNA AALLSNCGWF LDLQGVYEEA EAMHRRALEA REKVLGREHP DTLTSVSNLG       840
     LVLSSQGKYD EAEAMHRRAL EGYEEVLGRE HPNTLTSVNN LGSVLSRQGK YDEAEAMHRR       900
     DLEGSEKVLG REHPDTLTSV NNLGNVLSSQ GKYDEAEAMH RRALEGCEEV LGREHPNTLT       960
     SVNNLGSVLS RQGKYDEAEA MHRRDLEGSE KVLGREHPHT LASVNNLGNV LSSQGKYDEA      1020
     EAMHRRALEG YEEVLGREHP NTLTSVNNLG NVLSSQGKYD EAEAMHRRDL EGSEKVLGRE      1080
     HPDTLTSVSK LGNVLSSQGK YDEAEAMHRR DLEGSEKVLG REHPDTFTSV SNLGLVLSSQ      1140
     GKYDEAEAMH RRALEGYEEV LGREHPDTLT SVNNLGLVLS SQGKYDEAEA MHRRDLEGSE      1200
     KVLGREHPDT FTSVNNLGDV LSRQGKYDEA EAMHRRALEA REKVLGREHP DTLTSVSNLG      1260
     GVLFSQGKYD EAEAMHRRAL EARENVLGRE HPNTLTSLSN LGNVLSSQGK YDEAEAMHRR      1320
     ALEARENVLG REHPDTLTSV NNLGYILSSQ GKYDEAEAMH RRALEGYEEV LGREHPNTLT      1380
     SVNNLGDVLS RQGKYDEAEA MHRRALEARE KVLGREHPDT LTSVSNLGDV LSSQGKYDEA      1440
     EAMHRWALEA REKVLGREHP NTLTSVSNFG DVLSSQGKYD EAEAMHRRAL EAREKVLGRE      1500
     HPDTLTSVSK LGNVLSSQGK YDEAEAMHRR ALEAREKVLG REHPDTLTSV SKLGNVLSSQ      1560
     GKYDEAEAMH RRDLEGSEKV LGREHPDTFT SVSNLANVLS NQGKYDEAEA IHLQDMEGSE      1620
     KVLGREHPDT LTSVSKLGNV LSNQGKYDEA EAIHLQDMEG SEKVLGREHP DTLTSVSKLG      1680
     NVLSNQGKYD EAKAIHLQDM EGSEKVLGCE HPRILASLNI R                          1721
//

If you have problems or comments...

PBIL Back to PBIL home page