(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE220

PENCW_10.PE220       Location/Qualifiers
FT   CDS             complement(503512..504276)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048994" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824872"
FT                   /orf_name="Pc13g02200"
FT                   /product="Pc13g02200 protein"
FT                   /function="hydrolase activity, acting on ester bonds "
FT                   /biological_process="lipid metabolic process"
FT                   /protein_id="CAP91289.1"
FT                   /db_xref="GO:0006629"
FT                   /db_xref="GO:0016788"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR013830"
FT                   /db_xref="InterPro:IPR013831"
FT                   /db_xref="UniParc:UPI00018309F0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I6"
FT                   /transl_table=1
FT                   /translation="MESPKKLKIASLGSSFAAGPDIPPQIEPRAALRSGQNYPHLLAQH
FT                   LNADLTDLSVSGATLLNITVEPQATPFNVTFPPQSSDLPEDANIITVTAGGNDINYIGG
FT                   MIADACDAELQSSVSLSPSELAERLGGVLDQIHKRAPGARIFLVEYLAVLGPGTQAGRD
FT                   IPLTQERIQYHRGVADVLQHAYSVAVQGRTDWCETVPIHQLSQEHALGSKEPWVGGFES
FT                   GPLLHPNLDGMKAVADILAETIRKSTLSKALL"
     MESPKKLKIA SLGSSFAAGP DIPPQIEPRA ALRSGQNYPH LLAQHLNADL TDLSVSGATL        60
     LNITVEPQAT PFNVTFPPQS SDLPEDANII TVTAGGNDIN YIGGMIADAC DAELQSSVSL       120
     SPSELAERLG GVLDQIHKRA PGARIFLVEY LAVLGPGTQA GRDIPLTQER IQYHRGVADV       180
     LQHAYSVAVQ GRTDWCETVP IHQLSQEHAL GSKEPWVGGF ESGPLLHPNL DGMKAVADIL       240
     AETIRKSTLS KALL                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page