(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE221

PENCW_10.PE221       Location/Qualifiers
FT   CDS             505248..505661
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076574" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949830"
FT                   /orf_name="Pc13g02210"
FT                   /product="Pc13g02210 protein"
FT                   /protein_id="CAP91290.1"
FT                   /db_xref="UniParc:UPI00018309F1"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I7"
FT                   /transl_table=1
FT                   /translation="MQISQFLLATGLFASSILAAPITSSDWTILDMKRVCNGENTSCTW
FT                   TFGIDSGLDITDCTFIVEATDASHANGGPSTCGAYTVSSGWSGEFDPTNGFTTLSVANE
FT                   EIGQIIWPAYTDEQLADGDVVKPDQSYPPTAFP"
     MQISQFLLAT GLFASSILAA PITSSDWTIL DMKRVCNGEN TSCTWTFGID SGLDITDCTF        60
     IVEATDASHA NGGPSTCGAY TVSSGWSGEF DPTNGFTTLS VANEEIGQII WPAYTDEQLA       120
     DGDVVKPDQS YPPTAFP                                                      137
//

If you have problems or comments...

PBIL Back to PBIL home page