(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE222

PENCW_10.PE222       Location/Qualifiers
FT   CDS             complement(505971..506774)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000084336" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949831"
FT                   /orf_name="Pc13g02220"
FT                   /product="Pc13g02220 protein"
FT                   /function="proline racemase activity"
FT                   /protein_id="CAP91291.1"
FT                   /db_xref="GO:0018112"
FT                   /db_xref="InterPro:IPR008794"
FT                   /db_xref="UniParc:UPI00018309F2"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1I8"
FT                   /transl_table=1
FT                   /translation="MESEEYAPMSGSNTICTATVLLETGMVPMKEPITQLTLDTAAGLV
FT                   TVEAKCEGGKCKSVAFDNVPAFVFELDYQVLVPGLGEVSVDIAWGGMMYVLVAAASVGL
FT                   KVESRYSTQLVEIGERIKRAVQATYTPVHPVNPKIKGVSILAFTEPLVEENGCKAAVNT
FT                   VVVSPGRFDRSPCGTGTCARLAVLHARGQLAEGEVFKHRSIIGTEFTSHIRGTTRVGGY
FT                   KAVLPTVAGRAWITSFKQVVLDSSDPFPEGFRVGDQWQMAPSSLL"
     MESEEYAPMS GSNTICTATV LLETGMVPMK EPITQLTLDT AAGLVTVEAK CEGGKCKSVA        60
     FDNVPAFVFE LDYQVLVPGL GEVSVDIAWG GMMYVLVAAA SVGLKVESRY STQLVEIGER       120
     IKRAVQATYT PVHPVNPKIK GVSILAFTEP LVEENGCKAA VNTVVVSPGR FDRSPCGTGT       180
     CARLAVLHAR GQLAEGEVFK HRSIIGTEFT SHIRGTTRVG GYKAVLPTVA GRAWITSFKQ       240
     VVLDSSDPFP EGFRVGDQWQ MAPSSLL                                           267
//

If you have problems or comments...

PBIL Back to PBIL home page