(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE224

PENCW_10.PE224       Location/Qualifiers
FT   CDS             join(complement(510290..510925),complement(510042..510241),
FT                   complement(509382..509956),complement(509129..509322))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000162166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978065"
FT                   /orf_name="Pc13g02240"
FT                   /product="Pc13g02240 protein"
FT                   /function="amino acid transmembrane transporter activity "
FT                   /cellular_component="integral to membrane"
FT                   /protein_id="CAP91293.1"
FT                   /db_xref="GO:0015171"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="InterPro:IPR002293"
FT                   /db_xref="InterPro:IPR004840"
FT                   /db_xref="InterPro:IPR004841"
FT                   /db_xref="UniParc:UPI0001830AC6"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J0"
FT                   /transl_table=1
FT                   /translation="MADEVTAPQQHSSKNKGSEPHPPGQFPSVEEGKQTSANGVLEALG
FT                   YEPELVRNRSTLQVAFMSFVLAAIPYGLATTFTYPLIGGGPVNIIWGWLAVSLITLCVA
FT                   ASLGEITSVYPTAGGVYYQTFMLSPPSYRRIASWICGWSYVVGNITITLAVNLGSTLFF
FT                   VSCINVFESAPGVGIFQATTYQVFLIFLAVTFLANAISAFGNKWLPYLDTFAIFWTLAG
FT                   VLAIVICILAIAKEGRHDAEYVFTSFEPASGWPAGWSFCVGLLQAAYTTSSTGMVICMC
FT                   EEVREPSTQVPKAMVGTVILNTLAGFLFLVPLVFVLPDTKVLAALESGQPVPSIIKSAI
FT                   GSPVGSFLLLLPLILLSLFCVIGCTTAVSRSTWAFARDGGIPGSVWWRQVNRDGVPFNA
FT                   MMLGMTVQILLGFIYFGSTTAFNAFTGVGVITLTVSYVCPIVVSLAGGRRHIKNGQFDL
FT                   GTLGLVCNIVALGWCILVIPLFCMPSSIPVAANTVNYAPVVFVAFILVASGWYWVWGYE
FT                   KYVGPPTMDDEFRSSAW"
     MADEVTAPQQ HSSKNKGSEP HPPGQFPSVE EGKQTSANGV LEALGYEPEL VRNRSTLQVA        60
     FMSFVLAAIP YGLATTFTYP LIGGGPVNII WGWLAVSLIT LCVAASLGEI TSVYPTAGGV       120
     YYQTFMLSPP SYRRIASWIC GWSYVVGNIT ITLAVNLGST LFFVSCINVF ESAPGVGIFQ       180
     ATTYQVFLIF LAVTFLANAI SAFGNKWLPY LDTFAIFWTL AGVLAIVICI LAIAKEGRHD       240
     AEYVFTSFEP ASGWPAGWSF CVGLLQAAYT TSSTGMVICM CEEVREPSTQ VPKAMVGTVI       300
     LNTLAGFLFL VPLVFVLPDT KVLAALESGQ PVPSIIKSAI GSPVGSFLLL LPLILLSLFC       360
     VIGCTTAVSR STWAFARDGG IPGSVWWRQV NRDGVPFNAM MLGMTVQILL GFIYFGSTTA       420
     FNAFTGVGVI TLTVSYVCPI VVSLAGGRRH IKNGQFDLGT LGLVCNIVAL GWCILVIPLF       480
     CMPSSIPVAA NTVNYAPVVF VAFILVASGW YWVWGYEKYV GPPTMDDEFR SSAW             534
//

If you have problems or comments...

PBIL Back to PBIL home page