(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE225

PENCW_10.PE225       Location/Qualifiers
FT   CDS             complement(513181..514125)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076575" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824873"
FT                   /orf_name="Pc13g02250"
FT                   /product="Pc13g02250 protein"
FT                   /protein_id="CAP91294.1"
FT                   /db_xref="InterPro:IPR002575"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="UniParc:UPI0001830AC7"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J1"
FT                   /transl_table=1
FT                   /translation="MACLVKTMRDPPRESIAQVDGDANTWLIGPLQLHCRKGSSGTFTW
FT                   YDEDDNLSYTLTDAPDPLPPTIPLDDPRFKLVYDAGDSSAVWSVGNSAFCKVKLCRQGV
FT                   TSEAATLKFVQKLVYEQQPDFKIPKVLHQTEHNDRSYLFLTRVQGRTLGDAWPTLDEKW
FT                   RQHYIKAIVNVCKFLESQECDKLCGADGKNALELYLIKYGAEKDYSPDNLRQGCILIGM
FT                   DCSKFVFYHADLGPRNIIVEDIPKTGTVGIIDWELAGYFPRGWIRTKFRISSGLNLPDT
FT                   ATDKPTAWRSGVQELLGEDGFEHYAPEWLSWWD"
     MACLVKTMRD PPRESIAQVD GDANTWLIGP LQLHCRKGSS GTFTWYDEDD NLSYTLTDAP        60
     DPLPPTIPLD DPRFKLVYDA GDSSAVWSVG NSAFCKVKLC RQGVTSEAAT LKFVQKLVYE       120
     QQPDFKIPKV LHQTEHNDRS YLFLTRVQGR TLGDAWPTLD EKWRQHYIKA IVNVCKFLES       180
     QECDKLCGAD GKNALELYLI KYGAEKDYSP DNLRQGCILI GMDCSKFVFY HADLGPRNII       240
     VEDIPKTGTV GIIDWELAGY FPRGWIRTKF RISSGLNLPD TATDKPTAWR SGVQELLGED       300
     GFEHYAPEWL SWWD                                                         314
//

If you have problems or comments...

PBIL Back to PBIL home page