(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE226

PENCW_10.PE226       Location/Qualifiers
FT   CDS             join(515497..515601,515684..517471)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949833"
FT                   /orf_name="Pc13g02260"
FT                   /product="Pc13g02260 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91295.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="UniParc:UPI0001830AC8"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J2"
FT                   /transl_table=1
FT                   /translation="MENTKELPSPQKKRQNPNRCRPKSRGGCQRCKQRRRRCDEAKPSC
FT                   QECTKRGHTCPGYQKQSLQWRYVFKGSEEAHQPVPPIGSPSTIATESFEVNNSTEQGKD
FT                   NIQDETHNIWDTACPNLFDQLPNFDGPTDAWFYTESTSNGTALGKPDGEVDGLSILRQR
FT                   LAHTSVPSFLIQLPVMLVQYYFHTVCNQWSSFDCPLNPFRTIISRLWSRNAAIYFAIQS
FT                   MSAASLANDFPTMRAIGIQTQQQAIACLNNSVQKGSTQTKDDEYFLALLMIGSTTAWHD
FT                   ASDLGLPYLRAAQDHLLRQERQYKNADSALAKQHPLFKQCLLWWNLLAAFVTEDSPIVD
FT                   VESSIENSETDLAVYLVDGQILPHPWTGSLRYSLSLFYRTARIIRAAKTSHRRRPEALD
FT                   PTLIDLTSMAEELELRQEAENLEDKILFTGFSFYCGPIDIGDSNTPPSHFLTLAEVYRC
FT                   TALLQIYHVFPEILEERLQSNQAADDESPIPALFLVLFPVAAEWSSCSVEDARHTLALH
FT                   IVSLLEQLPSTSGTKVMQPVVLACISSDLVFSSGSVLGAIENAIPSLNTLDVDIAQARR
FT                   KVKMRLSELTIILPKLPMQRIYNVVHETWDRADSGLEEFWLDVMVDLNLETIMG"
     MENTKELPSP QKKRQNPNRC RPKSRGGCQR CKQRRRRCDE AKPSCQECTK RGHTCPGYQK        60
     QSLQWRYVFK GSEEAHQPVP PIGSPSTIAT ESFEVNNSTE QGKDNIQDET HNIWDTACPN       120
     LFDQLPNFDG PTDAWFYTES TSNGTALGKP DGEVDGLSIL RQRLAHTSVP SFLIQLPVML       180
     VQYYFHTVCN QWSSFDCPLN PFRTIISRLW SRNAAIYFAI QSMSAASLAN DFPTMRAIGI       240
     QTQQQAIACL NNSVQKGSTQ TKDDEYFLAL LMIGSTTAWH DASDLGLPYL RAAQDHLLRQ       300
     ERQYKNADSA LAKQHPLFKQ CLLWWNLLAA FVTEDSPIVD VESSIENSET DLAVYLVDGQ       360
     ILPHPWTGSL RYSLSLFYRT ARIIRAAKTS HRRRPEALDP TLIDLTSMAE ELELRQEAEN       420
     LEDKILFTGF SFYCGPIDIG DSNTPPSHFL TLAEVYRCTA LLQIYHVFPE ILEERLQSNQ       480
     AADDESPIPA LFLVLFPVAA EWSSCSVEDA RHTLALHIVS LLEQLPSTSG TKVMQPVVLA       540
     CISSDLVFSS GSVLGAIENA IPSLNTLDVD IAQARRKVKM RLSELTIILP KLPMQRIYNV       600
     VHETWDRADS GLEEFWLDVM VDLNLETIMG                                        630
//

If you have problems or comments...

PBIL Back to PBIL home page