(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE227

PENCW_10.PE227       Location/Qualifiers
FT   CDS             join(complement(519177..519236),complement(519051..519129),
FT                   complement(518782..518998),complement(518495..518735),
FT                   complement(518284..518445),complement(518074..518232))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000063755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129230"
FT                   /orf_name="Pc13g02270"
FT                   /product="Pc13g02270 protein"
FT                   /function="catalytic activity"
FT                   /protein_id="CAP91296.1"
FT                   /db_xref="GO:0003824"
FT                   /db_xref="InterPro:IPR002529"
FT                   /db_xref="InterPro:IPR011234"
FT                   /db_xref="UniParc:UPI0001830AC9"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J3"
FT                   /transl_table=1
FT                   /translation="MGVSNMNQMEFQDTPAAKHPVWKRWVRFRAEDGKIYGGEPVNPDI
FT                   DVGQAIEKDVEVSVKVVTGNSALDYDAPFTGEIKTIDELLSPVSQAEAGTVRCVGLNYK
FT                   EHAAEMKLTLPNTPTVFLKASTCIASASEPIILPSNVDYDEADYEVELAIIIGRQCKNV
FT                   SVSKAGDYVLGYAVANDVTARKHQEKTSQWSYAKGMDGFCPLGPCIVSTEQIPDAARLN
FT                   LKTRLNGKIMQNGSADDMIFSIPEIVSYVSQGHTLLPGTVIITGTPCGIGISQSPPQFL
FT                   QPGDELRISISHGLGTQICPIARA"
     MGVSNMNQME FQDTPAAKHP VWKRWVRFRA EDGKIYGGEP VNPDIDVGQA IEKDVEVSVK        60
     VVTGNSALDY DAPFTGEIKT IDELLSPVSQ AEAGTVRCVG LNYKEHAAEM KLTLPNTPTV       120
     FLKASTCIAS ASEPIILPSN VDYDEADYEV ELAIIIGRQC KNVSVSKAGD YVLGYAVAND       180
     VTARKHQEKT SQWSYAKGMD GFCPLGPCIV STEQIPDAAR LNLKTRLNGK IMQNGSADDM       240
     IFSIPEIVSY VSQGHTLLPG TVIITGTPCG IGISQSPPQF LQPGDELRIS ISHGLGTQIC       300
     PIARA                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page