(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE228

PENCW_10.PE228       Location/Qualifiers
FT   CDS             join(519855..520033,520087..520111,520167..520200,
FT                   520254..520458,520516..520620,520674..521240,5
FT                   21298..521469)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949834"
FT                   /orf_name="Pc13g02280"
FT                   /product="Pc13g02280 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP91297.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI0001830ACA"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J4"
FT                   /transl_table=1
FT                   /translation="MDKETDIKQTDLSSDHDVQMGNFVVDPIREKRLLWKLDLCICPLV
FT                   MLIFLVAYLDRSNLGNAAVAGMPEDIGLIGNELGNAVSLFYATYVFFEIPFSMLLKKLR
FT                   PNRLISALIIGFSVSILAAGFIKNAAGLYITRLFLGVFESGLFPCLTVLLTTFYKREEQ
FT                   AQRISYLFVSAALSGGFGGLLAFGLVRLDGAGGLEGWRWLFIVEGIMSAVVGIATFFLL
FT                   PNNYETAYFLNEDDKELMRMRMQQSARYADTEEFDIKEVWKTLRDPKSWLTSFNQICVN
FT                   ICSFGFSTFLPTIIRGFGFDSVKTQLLTVPVYIWASAFYLVVANLSDRVRMRAVFMVPL
FT                   CLVTAVGYAMLLGVDVHARGPLYFATYVCVTGIYAVVGLGVSWNANSHSGYYKRAMGVG
FT                   LQQTIGNCAGLIVSGISYWHARVVALTSS"
     MDKETDIKQT DLSSDHDVQM GNFVVDPIRE KRLLWKLDLC ICPLVMLIFL VAYLDRSNLG        60
     NAAVAGMPED IGLIGNELGN AVSLFYATYV FFEIPFSMLL KKLRPNRLIS ALIIGFSVSI       120
     LAAGFIKNAA GLYITRLFLG VFESGLFPCL TVLLTTFYKR EEQAQRISYL FVSAALSGGF       180
     GGLLAFGLVR LDGAGGLEGW RWLFIVEGIM SAVVGIATFF LLPNNYETAY FLNEDDKELM       240
     RMRMQQSARY ADTEEFDIKE VWKTLRDPKS WLTSFNQICV NICSFGFSTF LPTIIRGFGF       300
     DSVKTQLLTV PVYIWASAFY LVVANLSDRV RMRAVFMVPL CLVTAVGYAM LLGVDVHARG       360
     PLYFATYVCV TGIYAVVGLG VSWNANSHSG YYKRAMGVGL QQTIGNCAGL IVSGISYWHA       420
     RVVALTSS                                                                428
//

If you have problems or comments...

PBIL Back to PBIL home page