(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE23

PENCW_10.PE23        Location/Qualifiers
FT   CDS             join(56357..57123,57198..57969)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235071" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671895"
FT                   /orf_name="Pc13g00230"
FT                   /product="Pc13g00230 protein"
FT                   /protein_id="CAP91092.1"
FT                   /db_xref="UniParc:UPI0001830DBF"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H6"
FT                   /transl_table=1
FT                   /translation="MIASGELIPFDTQTSDSETETSKSGLGKVREETQYEDGDDIELDE
FT                   YIIDIRHIVTSLSVFHFLDYSGVFNRGSYRFVSTLENPAGNDKSFTDYNGPSLSETGCF
FT                   PRHPSTRTRVNKILAEPIGLASGLQALAKFAFQCSTTLHETVNSFRSHYKPVRGLLEEL
FT                   EALSAVLGPLAEFVTSTADIDMSALDLPLLRCGSACKGFQQEILQLSSRSDKGQPNFQD
FT                   WARLKYMDDDIDGFQTMLAGYKATFNIALADANLRQSSVNTEILDDYKRLIQNTEVDLE
FT                   DRLKIIDSKLECIVEKSVTQSEPGAAELQYMKEERLSTEKCLQICAQLSDHIDHIQLMS
FT                   DGGGASHHPDTLGIPPETVTNESLQECKNNLSLTAARLEKHMQDTMNRQLSRPNTATSS
FT                   KIDEEDLTRLQDGCITAQQCLDICSKADSHLKDNDNVIEDYGPGDGSKFKVSTYGDVLH
FT                   AKTRAHGWRTQQLGGYRSEDTVQRLSRDIATINMSHLDGGEPHSTDRRPLDECD"
     MIASGELIPF DTQTSDSETE TSKSGLGKVR EETQYEDGDD IELDEYIIDI RHIVTSLSVF        60
     HFLDYSGVFN RGSYRFVSTL ENPAGNDKSF TDYNGPSLSE TGCFPRHPST RTRVNKILAE       120
     PIGLASGLQA LAKFAFQCST TLHETVNSFR SHYKPVRGLL EELEALSAVL GPLAEFVTST       180
     ADIDMSALDL PLLRCGSACK GFQQEILQLS SRSDKGQPNF QDWARLKYMD DDIDGFQTML       240
     AGYKATFNIA LADANLRQSS VNTEILDDYK RLIQNTEVDL EDRLKIIDSK LECIVEKSVT       300
     QSEPGAAELQ YMKEERLSTE KCLQICAQLS DHIDHIQLMS DGGGASHHPD TLGIPPETVT       360
     NESLQECKNN LSLTAARLEK HMQDTMNRQL SRPNTATSSK IDEEDLTRLQ DGCITAQQCL       420
     DICSKADSHL KDNDNVIEDY GPGDGSKFKV STYGDVLHAK TRAHGWRTQQ LGGYRSEDTV       480
     QRLSRDIATI NMSHLDGGEP HSTDRRPLDE CD                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page