(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE231

PENCW_10.PE231       Location/Qualifiers
FT   CDS             join(complement(533442..533452),complement(533368..533385),
FT                   complement(527899..533301),complement(527539..527833))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210415" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949836"
FT                   /orf_name="Pc13g02310"
FT                   /product="Pc13g02310 protein"
FT                   /function="ATP binding"
FT                   /function="DNA binding"
FT                   /function="helicase activity"
FT                   /protein_id="CAP91300.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0004386"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="InterPro:IPR000330"
FT                   /db_xref="InterPro:IPR001650"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR014001"
FT                   /db_xref="InterPro:IPR014021"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="InterPro:IPR022707"
FT                   /db_xref="UniParc:UPI0001830ACD"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H2"
FT                   /transl_table=1
FT                   /translation="MASRLDRLVTLLETGSTQLIRNTAAQQLADVQKQHPDELFNLLGR
FT                   ILPYLRSKSWDTRTASAKAIGLIVSNADIHDPNEDDGLQIKSAAEEDDVEIKSEIKSEE
FT                   PIPADDFLKLDTLDIPSVLKYGKRLLGSAGKEYEYSLASMEPASRLQHQKKTLTSRLGL
FT                   EGEYLEEDLIEDIELAPKVVTPAPKHEPTIPPIPHHSSLHEASSRRPSSPSESATKEDG
FT                   GLSKRQLNQLKRKNKQNAKMGANKVRVVDLSSRRQSDIVTTPLATTPHPVKAENGDDHN
FT                   GETKPDYFSFERTEEDDDSKLVTEFKGAVAPERPHILPDIVEQGAGWPLEHMCEFLTMD
FT                   IFDSNWEVRHGAAMALREVIRVQGAAAGRLDGKSRSENDALNRRWLDDLSCRLLCVLML
FT                   DRFGDYISDNVVAPIRETVGQTLGALLSHLHPNSVRAAYRCLYRIIMQTDLGLDRPVWE
FT                   VCHGGMIGLRYLVAVRKDLLVKDSNMMDGVLEAVMKGLADYDDDVRAVSAATLVPIAEE
FT                   FVSSRTGTLGPLMNIVWDCLSNLQDDLSASTGSVMDLLAKLCTFSQVLDAMKANAADDP
FT                   EASFGKLVPRLYPFLRHTITSVRSAVLRALMTFLKLEGEGTTDWVDGKALRLIFQNLLV
FT                   ERNEGVLKLSGQVWSELLNVVEMRGSFKSEDELSGSIQPLITLTLGAFGVPRYPIPMNT
FT                   SLFIKPSGLPFSAALPAPTPSKGSPPASIPGGAETKVGRRRKSEKKEKEPPPPSAHNVD
FT                   GHMLSGDIDLVGADTMLRSKIYAAKALGALISFWDKNELSSLWPAILDGLNASASTTQL
FT                   ASAMVLEEYARQSGPESKYRSSLCDRLRPILEGERPSWYSDIACYLHVARSQCHSLLNT
FT                   FRDHAHVAPSRLPTLAVVVQGDSEAGPNAFSLADAEKIVGPDFDRLKKNLTPAQRITAT
FT                   QVLNDTRTTAQSAVEEARLMREQRDMRVLAATAGALVALRDIPKKPGHIIKGMMDSVKK
FT                   EENVELQQRSATAVAGLIEHYTAATKRGPVDKIIGNLVKYCCVDTSETPEFPHNVQLEK
FT                   SILSLRKEEDRRDHPDAAKFEREAREARIMRRGAKDALEQLAVKFGPELLEKVPNLAKL
FT                   VERPLRDALAGDELPEDITNPENELGQEIVDGLSTLRALLPKFDPGLHEWVIDLMPIIA
FT                   KGLQCRLSVIRYAAAKCFATICSVITVKGMTMLVEKVLPLINNGLDVNHRQGAIECIYH
FT                   LIHVMEDGILPYVIFLVVPVLGRMSDSDNDVRLLATTSFATLVKLVPLEAGIPDPPGFS
FT                   AELLEGRDRERKFMSQMLDVRKVEPFEIPVAIKAELRPYQQDGVNWLAFLNRYNLHGIL
FT                   CDDMGLGKTLQTICIVASDHHMRAEEFAKSQSTDSRKLPSLIVCPPSLSGHWQQEVKQY
FT                   APFLSCIAYVGPPAERTRLQPLLATTDVIVTSYDVCRNDNDILSPINFNYCVLDEGHLI
FT                   KNPKAKITSSVKKLASNHRLILSGTPIQNNVLELWSLFDFLMPGFLGTEKVFLDRFAKP
FT                   IAASRFSKSSSKEQEAGALAIEALHKQVLPFLLRRLKEEVLNDLPPKIIQNYYCDPSEL
FT                   QKKLFEDFTKKEQKELADKVGSADRGDKEHIFQALQYMRRLCNSPALVVKEGHKQYNEV
FT                   QSFLSAKRSNIRDVSHAPKLNALKDLLVDCGIGLDHTAEGELDTGASYVSPHRALVFCQ
FT                   MKEMLDIVQNDVLKKLLPSVQYLRLDGGVEATKRQDIVNRFNTDPSYDVLLLTTSVGGL
FT                   GLNLTGADTVIFVEHDWNPQKDIQAMDRAHRIGQKKVVNVYRLITRGTLEEKILNLQRF
FT                   KIDVASTVVNQQNAGLGTMDTDQLLDLFNLGETADTAEKPSDTAGYEVDMVDIDGEVKE
FT                   KGKKGWLDDLGELWDDRQYQEEYNLDSFLETMKN"
     MASRLDRLVT LLETGSTQLI RNTAAQQLAD VQKQHPDELF NLLGRILPYL RSKSWDTRTA        60
     SAKAIGLIVS NADIHDPNED DGLQIKSAAE EDDVEIKSEI KSEEPIPADD FLKLDTLDIP       120
     SVLKYGKRLL GSAGKEYEYS LASMEPASRL QHQKKTLTSR LGLEGEYLEE DLIEDIELAP       180
     KVVTPAPKHE PTIPPIPHHS SLHEASSRRP SSPSESATKE DGGLSKRQLN QLKRKNKQNA       240
     KMGANKVRVV DLSSRRQSDI VTTPLATTPH PVKAENGDDH NGETKPDYFS FERTEEDDDS       300
     KLVTEFKGAV APERPHILPD IVEQGAGWPL EHMCEFLTMD IFDSNWEVRH GAAMALREVI       360
     RVQGAAAGRL DGKSRSENDA LNRRWLDDLS CRLLCVLMLD RFGDYISDNV VAPIRETVGQ       420
     TLGALLSHLH PNSVRAAYRC LYRIIMQTDL GLDRPVWEVC HGGMIGLRYL VAVRKDLLVK       480
     DSNMMDGVLE AVMKGLADYD DDVRAVSAAT LVPIAEEFVS SRTGTLGPLM NIVWDCLSNL       540
     QDDLSASTGS VMDLLAKLCT FSQVLDAMKA NAADDPEASF GKLVPRLYPF LRHTITSVRS       600
     AVLRALMTFL KLEGEGTTDW VDGKALRLIF QNLLVERNEG VLKLSGQVWS ELLNVVEMRG       660
     SFKSEDELSG SIQPLITLTL GAFGVPRYPI PMNTSLFIKP SGLPFSAALP APTPSKGSPP       720
     ASIPGGAETK VGRRRKSEKK EKEPPPPSAH NVDGHMLSGD IDLVGADTML RSKIYAAKAL       780
     GALISFWDKN ELSSLWPAIL DGLNASASTT QLASAMVLEE YARQSGPESK YRSSLCDRLR       840
     PILEGERPSW YSDIACYLHV ARSQCHSLLN TFRDHAHVAP SRLPTLAVVV QGDSEAGPNA       900
     FSLADAEKIV GPDFDRLKKN LTPAQRITAT QVLNDTRTTA QSAVEEARLM REQRDMRVLA       960
     ATAGALVALR DIPKKPGHII KGMMDSVKKE ENVELQQRSA TAVAGLIEHY TAATKRGPVD      1020
     KIIGNLVKYC CVDTSETPEF PHNVQLEKSI LSLRKEEDRR DHPDAAKFER EAREARIMRR      1080
     GAKDALEQLA VKFGPELLEK VPNLAKLVER PLRDALAGDE LPEDITNPEN ELGQEIVDGL      1140
     STLRALLPKF DPGLHEWVID LMPIIAKGLQ CRLSVIRYAA AKCFATICSV ITVKGMTMLV      1200
     EKVLPLINNG LDVNHRQGAI ECIYHLIHVM EDGILPYVIF LVVPVLGRMS DSDNDVRLLA      1260
     TTSFATLVKL VPLEAGIPDP PGFSAELLEG RDRERKFMSQ MLDVRKVEPF EIPVAIKAEL      1320
     RPYQQDGVNW LAFLNRYNLH GILCDDMGLG KTLQTICIVA SDHHMRAEEF AKSQSTDSRK      1380
     LPSLIVCPPS LSGHWQQEVK QYAPFLSCIA YVGPPAERTR LQPLLATTDV IVTSYDVCRN      1440
     DNDILSPINF NYCVLDEGHL IKNPKAKITS SVKKLASNHR LILSGTPIQN NVLELWSLFD      1500
     FLMPGFLGTE KVFLDRFAKP IAASRFSKSS SKEQEAGALA IEALHKQVLP FLLRRLKEEV      1560
     LNDLPPKIIQ NYYCDPSELQ KKLFEDFTKK EQKELADKVG SADRGDKEHI FQALQYMRRL      1620
     CNSPALVVKE GHKQYNEVQS FLSAKRSNIR DVSHAPKLNA LKDLLVDCGI GLDHTAEGEL      1680
     DTGASYVSPH RALVFCQMKE MLDIVQNDVL KKLLPSVQYL RLDGGVEATK RQDIVNRFNT      1740
     DPSYDVLLLT TSVGGLGLNL TGADTVIFVE HDWNPQKDIQ AMDRAHRIGQ KKVVNVYRLI      1800
     TRGTLEEKIL NLQRFKIDVA STVVNQQNAG LGTMDTDQLL DLFNLGETAD TAEKPSDTAG      1860
     YEVDMVDIDG EVKEKGKKGW LDDLGELWDD RQYQEEYNLD SFLETMKN                   1908
//

If you have problems or comments...

PBIL Back to PBIL home page