(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE232

PENCW_10.PE232       Location/Qualifiers
FT   CDS             join(complement(534984..535199),complement(534758..534900),
FT                   complement(534420..534468),complement(534213..534278))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978067"
FT                   /orf_name="Pc13g02320"
FT                   /product="Pc13g02320 protein"
FT                   /protein_id="CAP91301.1"
FT                   /db_xref="UniParc:UPI0001830ACE"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H4"
FT                   /transl_table=1
FT                   /translation="MASDHNLRTQFPPPRIKPANAVWLFLGPGRCYPFWQEVLGCYVVN
FT                   SGDGASGKKKCVPALDDYYECLHHRKEALRTMKMQAAYRKAEAAHPRENAPKAEQIRSL
FT                   GLLGKEEDAANVLSQREIGLLASPTRLAAYPGENNAQGKGEGNGIEDENLYTP"
     MASDHNLRTQ FPPPRIKPAN AVWLFLGPGR CYPFWQEVLG CYVVNSGDGA SGKKKCVPAL        60
     DDYYECLHHR KEALRTMKMQ AAYRKAEAAH PRENAPKAEQ IRSLGLLGKE EDAANVLSQR       120
     EIGLLASPTR LAAYPGENNA QGKGEGNGIE DENLYTP                                157
//

If you have problems or comments...

PBIL Back to PBIL home page