(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE233

PENCW_10.PE233       Location/Qualifiers
FT   CDS             join(535472..536999,537051..537207,537261..538362)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210383" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672166"
FT                   /orf_name="Pc13g02330"
FT                   /product="Pc13g02330 protein"
FT                   /protein_id="CAP91302.1"
FT                   /db_xref="InterPro:IPR013244"
FT                   /db_xref="UniParc:UPI0001830B76"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H5"
FT                   /transl_table=1
FT                   /translation="MALEELSDAHAILLATHLCASGSVADLPILQARFPHCFPLERLLR
FT                   IILTFLPESTEPSQYTTVLQELANSSNLPSDRPIDTSAVQDLSESLARKRVRKIHLRPL
FT                   QRPDEEDEIASADPLTKFLIHRAHLIDSETALQPLILDLIIPFYEHSPVIRTWLISSLL
FT                   PLLRLNYEFYAHRDETISLEILESMDDQTAVNILLSLMSSEENSMDLVNNLRGLIGPWL
FT                   YGGNRSKRRRLNEAAQQSSVSFIEGSEKPQATELAGWEHVNEWLLSRSLVDRDSVVGAF
FT                   TRWDGPSDVDLGGYDNGGTQLSEEQAKDLQVRYGQSGLAVVYAHADSSMAVLEGSFQVL
FT                   TRVAKLLDLEDSSYLTPDSELPSVHYDTESMSSTSRASLLQNSLLRPTNPLTKPSPPSV
FT                   SFLSALLLSLRILTELGHLVPCRVAANMCLHSTEEMQLAELKSVVDSTVKQPNLNQDWS
FT                   MVRQRLLWLRDWQAEQFDNAWDEPSPYHGLFWRIPRDTVEIEILKALLAAKEYELAIDI
FT                   YTNSKSAPLEPAQVEAAVQEAIFTAYDNASNGNRTRGGMKRAYDILQSFTPHFPDSVVF
FT                   KQIHALIAATHALSYYSLTLQHGVPFQPVSIRVHHDPILLIEKVLEQNAKSYTKLDDLL
FT                   SIGRNLVAADVPTQAASNEAEDEPTHHKPSKEHALLTAERRITSLAIASALSSNDFGTA
FT                   YSYILTRLTPPSLLSTSSPLLNTTSVPDDITWRAVYNAGRHRATTPTHPPPTLQSQISH
FT                   LSQRMELLSLSLVLVPSPDPLPEILGAWRRCDEELTSLRAREQQEEDLWDRKGDTLSSV
FT                   PGGFGPSDSERDAFDTERQRAARRARAAMPNSHHHEAPMGLFEVARGAALALHKNAFPL
FT                   RGAADGSAPLAPRDGDRPLSPDSEGHVRKRDMVSNMMTGGLVSGIGWVLGADPVNKK"
     MALEELSDAH AILLATHLCA SGSVADLPIL QARFPHCFPL ERLLRIILTF LPESTEPSQY        60
     TTVLQELANS SNLPSDRPID TSAVQDLSES LARKRVRKIH LRPLQRPDEE DEIASADPLT       120
     KFLIHRAHLI DSETALQPLI LDLIIPFYEH SPVIRTWLIS SLLPLLRLNY EFYAHRDETI       180
     SLEILESMDD QTAVNILLSL MSSEENSMDL VNNLRGLIGP WLYGGNRSKR RRLNEAAQQS       240
     SVSFIEGSEK PQATELAGWE HVNEWLLSRS LVDRDSVVGA FTRWDGPSDV DLGGYDNGGT       300
     QLSEEQAKDL QVRYGQSGLA VVYAHADSSM AVLEGSFQVL TRVAKLLDLE DSSYLTPDSE       360
     LPSVHYDTES MSSTSRASLL QNSLLRPTNP LTKPSPPSVS FLSALLLSLR ILTELGHLVP       420
     CRVAANMCLH STEEMQLAEL KSVVDSTVKQ PNLNQDWSMV RQRLLWLRDW QAEQFDNAWD       480
     EPSPYHGLFW RIPRDTVEIE ILKALLAAKE YELAIDIYTN SKSAPLEPAQ VEAAVQEAIF       540
     TAYDNASNGN RTRGGMKRAY DILQSFTPHF PDSVVFKQIH ALIAATHALS YYSLTLQHGV       600
     PFQPVSIRVH HDPILLIEKV LEQNAKSYTK LDDLLSIGRN LVAADVPTQA ASNEAEDEPT       660
     HHKPSKEHAL LTAERRITSL AIASALSSND FGTAYSYILT RLTPPSLLST SSPLLNTTSV       720
     PDDITWRAVY NAGRHRATTP THPPPTLQSQ ISHLSQRMEL LSLSLVLVPS PDPLPEILGA       780
     WRRCDEELTS LRAREQQEED LWDRKGDTLS SVPGGFGPSD SERDAFDTER QRAARRARAA       840
     MPNSHHHEAP MGLFEVARGA ALALHKNAFP LRGAADGSAP LAPRDGDRPL SPDSEGHVRK       900
     RDMVSNMMTG GLVSGIGWVL GADPVNKK                                          928
//

If you have problems or comments...

PBIL Back to PBIL home page