(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE236

PENCW_10.PE236       Location/Qualifiers
FT   CDS             547999..548772
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949837"
FT                   /orf_name="Pc13g02360"
FT                   /product="Putative uncharacterized protein Pc13g02360 "
FT                   /protein_id="CAP91305.1"
FT                   /db_xref="UniParc:UPI0001830B79"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H8"
FT                   /transl_table=1
FT                   /translation="MLFCLSQRRTRESLKPPPDLDYPLMDLSSLEGAPIVNPRFIVPPD
FT                   TTTPRIRTQSRASIQHLFSKPLPPRPASTDGISPTQHRNTLQDWPLDLSTIDGNIKRAS
FT                   ARRRTRPPPNEVSPDCDPRGREMRPRIQHTPRPPVRPRSCVPLTWLEDEKKWLVGEIYI
FT                   PRTPDSRPRDDIASSRSPVSPISPISPWQDMFQRLDEHLEYNNRLCRENLLRQTPSYDG
FT                   HRLSQTHDPDLGDDRVSRWVATARRMHENRRIGGD"
     MLFCLSQRRT RESLKPPPDL DYPLMDLSSL EGAPIVNPRF IVPPDTTTPR IRTQSRASIQ        60
     HLFSKPLPPR PASTDGISPT QHRNTLQDWP LDLSTIDGNI KRASARRRTR PPPNEVSPDC       120
     DPRGREMRPR IQHTPRPPVR PRSCVPLTWL EDEKKWLVGE IYIPRTPDSR PRDDIASSRS       180
     PVSPISPISP WQDMFQRLDE HLEYNNRLCR ENLLRQTPSY DGHRLSQTHD PDLGDDRVSR       240
     WVATARRMHE NRRIGGD                                                      257
//

If you have problems or comments...

PBIL Back to PBIL home page