(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE237

PENCW_10.PE237       Location/Qualifiers
FT   CDS             join(551074..551257,551342..552503,552556..552808)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210360" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949838"
FT                   /orf_name="Pc13g02370"
FT                   /product="Pc13g02370 protein"
FT                   /function="heat shock protein binding"
FT                   /function="unfolded protein binding"
FT                   /biological_process="protein folding"
FT                   /protein_id="CAP91306.1"
FT                   /db_xref="GO:0006457"
FT                   /db_xref="GO:0031072"
FT                   /db_xref="GO:0051082"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR001623"
FT                   /db_xref="InterPro:IPR003095"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR015609"
FT                   /db_xref="InterPro:IPR018253"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="InterPro:IPR023114"
FT                   /db_xref="UniParc:UPI0001830B7A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H9"
FT                   /transl_table=1
FT                   /translation="MDIDSQGPQNNGVNGTEERSPTPPPHQPNSASADEADSFKLAGNK
FT                   FFKDGNYRRAIEEYNKAIEINPNSSAYLSNRAAAYMSAKQFLNALEDVQRSNELDPNNP
FT                   KIMHRWAKILTSLGRPEEALEVLSRIQPPATATDRAAAEKMLRFVTQAEQTIAEDRGLS
FT                   MVIYCLDQARQGLGQGVKEPRKWTLLAAEAHLRLDNVNSLGKAQDIAISLLRENSQDPD
FT                   AMMIRARAFYALGESEQAQKLLKMCLGLDPDMKQAIKLLRIVQKLARTKEEGNNAFKAK
FT                   DYHRAIELWAQALEVDPSNKDMNAKILGNRAQAYINLKEYDSAIEDCTEALRLDSGYIK
FT                   AMKCRAKAHGKAGNWEEAVRDYKSVAENNPNEPGIAEEIHEAEFELKKSQRKDYYKILG
FT                   VGKDASDQEIKKAYRKLAILYHPDKNRDGAAGDEKFKEIGEAYETLIDSQKRAAYDNGD
FT                   ELREGMPGGMHGGMHGFGGINPDILRDMMNGGGGFGGASFGGASFGGGGFGGGGFGGHS
FT                   HGGNPFGGPGAGFSF"
     MDIDSQGPQN NGVNGTEERS PTPPPHQPNS ASADEADSFK LAGNKFFKDG NYRRAIEEYN        60
     KAIEINPNSS AYLSNRAAAY MSAKQFLNAL EDVQRSNELD PNNPKIMHRW AKILTSLGRP       120
     EEALEVLSRI QPPATATDRA AAEKMLRFVT QAEQTIAEDR GLSMVIYCLD QARQGLGQGV       180
     KEPRKWTLLA AEAHLRLDNV NSLGKAQDIA ISLLRENSQD PDAMMIRARA FYALGESEQA       240
     QKLLKMCLGL DPDMKQAIKL LRIVQKLART KEEGNNAFKA KDYHRAIELW AQALEVDPSN       300
     KDMNAKILGN RAQAYINLKE YDSAIEDCTE ALRLDSGYIK AMKCRAKAHG KAGNWEEAVR       360
     DYKSVAENNP NEPGIAEEIH EAEFELKKSQ RKDYYKILGV GKDASDQEIK KAYRKLAILY       420
     HPDKNRDGAA GDEKFKEIGE AYETLIDSQK RAAYDNGDEL REGMPGGMHG GMHGFGGINP       480
     DILRDMMNGG GGFGGASFGG ASFGGGGFGG GGFGGHSHGG NPFGGPGAGF SF               532
//

If you have problems or comments...

PBIL Back to PBIL home page