(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE238

PENCW_10.PE238       Location/Qualifiers
FT   CDS             complement(553935..556187)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129233"
FT                   /orf_name="Pc13g02380"
FT                   /product="Pc13g02380 protein"
FT                   /protein_id="CAP91307.1"
FT                   /db_xref="UniParc:UPI0001830B7B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G7"
FT                   /transl_table=1
FT                   /translation="MDDGPPPPPPPHGENPHTTQGEYRKSSDLPDGNYDIFIVPPHSAG
FT                   SGFLYLPSLQCNRNSFLAGVASTLVACFVWSYISPIVKAWYLATVASGSGTGMAVLAIG
FT                   VGVAGWLFGSIQSTSSGDNKGNGGARGGRFGFGGFGGGSGGPGDPGGPGGPRNAGPNTN
FT                   QYSSGANYGGNGAGQQRQQGGNFGGGQPHGNQYSGNQHGSGTPPNSDNNKREKEEAEKR
FT                   AKEERAKEERAREQRAKEERAREERAREERAREERVREERAKQERAREERAREERAREE
FT                   RIKEERAREERAKERAKEEAERERAREETRRKEELRRKMEEFKRKRDAEAKEKEKKRER
FT                   EAMEKELQERREQLEREMAAARAAAEKEARERLEREAAEARERQAKAEAEAKAKLEKLE
FT                   AEAKEKAAKEAAEKEAAAKAAAQKEAMAKFAALKEAASKKYAEKKAQDAKKEAAAKSPP
FT                   PKPASTSNVPRTPSPKKPAPYSTAKTANEDDAYSFRPYDRPRRPYAAGSVYSESSYTPS
FT                   NSTARTTPPPSHRSTYSTKDPDKIVIQGVYAFNNAFMKTPVAQLVSGQGMITDGLVLRI
FT                   TTEGLFIDDDLRGIGQREWDVKAWTLKLAEVWCPQVNAASSAKTASSNPFSFRRGNNVP
FT                   TNEESEAFLGNLLKVCKNTCRLASPSACFARSATASHDGGPVHPPQAEFRGLHILRASV
FT                   RDQEGKKYVFVLQDTEAWKVAIGLQRLRGGALVRALGVSALPVPECKTMLSALGYV"
     MDDGPPPPPP PHGENPHTTQ GEYRKSSDLP DGNYDIFIVP PHSAGSGFLY LPSLQCNRNS        60
     FLAGVASTLV ACFVWSYISP IVKAWYLATV ASGSGTGMAV LAIGVGVAGW LFGSIQSTSS       120
     GDNKGNGGAR GGRFGFGGFG GGSGGPGDPG GPGGPRNAGP NTNQYSSGAN YGGNGAGQQR       180
     QQGGNFGGGQ PHGNQYSGNQ HGSGTPPNSD NNKREKEEAE KRAKEERAKE ERAREQRAKE       240
     ERAREERARE ERAREERVRE ERAKQERARE ERAREERARE ERIKEERARE ERAKERAKEE       300
     AERERAREET RRKEELRRKM EEFKRKRDAE AKEKEKKRER EAMEKELQER REQLEREMAA       360
     ARAAAEKEAR ERLEREAAEA RERQAKAEAE AKAKLEKLEA EAKEKAAKEA AEKEAAAKAA       420
     AQKEAMAKFA ALKEAASKKY AEKKAQDAKK EAAAKSPPPK PASTSNVPRT PSPKKPAPYS       480
     TAKTANEDDA YSFRPYDRPR RPYAAGSVYS ESSYTPSNST ARTTPPPSHR STYSTKDPDK       540
     IVIQGVYAFN NAFMKTPVAQ LVSGQGMITD GLVLRITTEG LFIDDDLRGI GQREWDVKAW       600
     TLKLAEVWCP QVNAASSAKT ASSNPFSFRR GNNVPTNEES EAFLGNLLKV CKNTCRLASP       660
     SACFARSATA SHDGGPVHPP QAEFRGLHIL RASVRDQEGK KYVFVLQDTE AWKVAIGLQR       720
     LRGGALVRAL GVSALPVPEC KTMLSALGYV                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page