(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE239

PENCW_10.PE239       Location/Qualifiers
FT   CDS             join(558256..559147,559209..559306,559360..561405)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210316" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949839"
FT                   /orf_name="Pc13g02390"
FT                   /product="Pc13g02390 protein"
FT                   /function="ATP binding"
FT                   /function="protein serine/threonine kinase activity "
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP91308.1"
FT                   /db_xref="GO:0004674"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR008271"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI0001830B7C"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G8"
FT                   /transl_table=1
FT                   /translation="MSSQSHHGHSATPRQFPVYNPVAAVAAPAGTLLPGTKIQVGSHRV
FT                   VVEKYLSEGGFAHVYVVRLPQPVNGSETAVLKRVAVPDKAALANMRTEVETMKKLKGHR
FT                   HIVKYIDSHASQLRGGGYEVFLVMEYCAGGGLIDFMNTRLQHRLTEPEIVKIFSDVAEG
FT                   VACMHYLKPPLLHRDLKVENVLISGKGSSATYKLCDFGSSAPPRPAATSAAEGRLIEDD
FT                   VQRHTTLQYRSPEMIDVYRKQPIDEKSDIWALGVFLYKLCYYTTPFEEVGQMAILNATF
FT                   KYPSYPSFSSRLKLLIGSMLKEDPRNRPNIYEVVREVCKMQGKEVPIKDIYSNRSVSEA
FT                   RKYQELPPTPTEAPAVGAVFSPPMQETEIIPEIAPMRRGRPGKSSSSQPSSERPSPSPY
FT                   RPAAEGSSSDPFAALDGSAARKKTAEEMSKRFPSLDQFDILHEKGDKFEFEPTVESKPE
FT                   DEDLSRRLTNALADDAFARRVSPERAPKPVYKRPSQNSPVRAPNLRETPAPQSVPLYQP
FT                   TPQRPTMVSTGTMTSPIQTPRLPDPKLLSRPIYRFPSSDAEHRSFSEPFTTEKEQRVTR
FT                   PHKAPSPPMSSLNVEESSRLPSDRISSQSNSARPSMETLRRPPTLEVNEPVGRSKSAIG
FT                   KARPMSVQAGVRYDPPYDSESPRSSLDMSRLQYEGGAPLRSVRTDVDRESDRTISSDVD
FT                   YLRAMEEEESNRKREKRSSGSHKHNKRGSLSTLSLSGGKNLFAGRFGDAFRRFEAGNPE
FT                   KSSSPSVEDAPRQGLIGTSDSADEGLSPNDEITLEDADRDDISPEMRRELERRRLSQEE
FT                   KRVANAAAEYRRRVAETGDGGGRTTGDGARSRTIQNKVQSLLGESEKPTVPKTATGYGR
FT                   FTETSSSLQAKQSEARPTSSSQLPASHTSGPTYAARDGSMALPDRRELPQSAAPTPYPS
FT                   TQRPAARPAAPPKPKNLRAGTATSRPGTGHDHGPSQETQTPASPGDDWEAKFSQRFPSL
FT                   SGLEMETEIKIPKISSLRTREV"
     MSSQSHHGHS ATPRQFPVYN PVAAVAAPAG TLLPGTKIQV GSHRVVVEKY LSEGGFAHVY        60
     VVRLPQPVNG SETAVLKRVA VPDKAALANM RTEVETMKKL KGHRHIVKYI DSHASQLRGG       120
     GYEVFLVMEY CAGGGLIDFM NTRLQHRLTE PEIVKIFSDV AEGVACMHYL KPPLLHRDLK       180
     VENVLISGKG SSATYKLCDF GSSAPPRPAA TSAAEGRLIE DDVQRHTTLQ YRSPEMIDVY       240
     RKQPIDEKSD IWALGVFLYK LCYYTTPFEE VGQMAILNAT FKYPSYPSFS SRLKLLIGSM       300
     LKEDPRNRPN IYEVVREVCK MQGKEVPIKD IYSNRSVSEA RKYQELPPTP TEAPAVGAVF       360
     SPPMQETEII PEIAPMRRGR PGKSSSSQPS SERPSPSPYR PAAEGSSSDP FAALDGSAAR       420
     KKTAEEMSKR FPSLDQFDIL HEKGDKFEFE PTVESKPEDE DLSRRLTNAL ADDAFARRVS       480
     PERAPKPVYK RPSQNSPVRA PNLRETPAPQ SVPLYQPTPQ RPTMVSTGTM TSPIQTPRLP       540
     DPKLLSRPIY RFPSSDAEHR SFSEPFTTEK EQRVTRPHKA PSPPMSSLNV EESSRLPSDR       600
     ISSQSNSARP SMETLRRPPT LEVNEPVGRS KSAIGKARPM SVQAGVRYDP PYDSESPRSS       660
     LDMSRLQYEG GAPLRSVRTD VDRESDRTIS SDVDYLRAME EEESNRKREK RSSGSHKHNK       720
     RGSLSTLSLS GGKNLFAGRF GDAFRRFEAG NPEKSSSPSV EDAPRQGLIG TSDSADEGLS       780
     PNDEITLEDA DRDDISPEMR RELERRRLSQ EEKRVANAAA EYRRRVAETG DGGGRTTGDG       840
     ARSRTIQNKV QSLLGESEKP TVPKTATGYG RFTETSSSLQ AKQSEARPTS SSQLPASHTS       900
     GPTYAARDGS MALPDRRELP QSAAPTPYPS TQRPAARPAA PPKPKNLRAG TATSRPGTGH       960
     DHGPSQETQT PASPGDDWEA KFSQRFPSLS GLEMETEIKI PKISSLRTRE V               1011
//

If you have problems or comments...

PBIL Back to PBIL home page