(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE240

PENCW_10.PE240       Location/Qualifiers
FT   CDS             join(561742..561772,561826..561922,562060..562450)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048306" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978068"
FT                   /orf_name="Pc13g02400"
FT                   /product="Pc13g02400 protein"
FT                   /function="RNA polymerase II transcription mediator
FT                   activity"
FT                   /biological_process="regulation of transcription from RNA
FT                   polymerase II promoter"
FT                   /cellular_component="mediator complex"
FT                   /protein_id="CAP91309.1"
FT                   /db_xref="GO:0006357"
FT                   /db_xref="GO:0016455"
FT                   /db_xref="GO:0016592"
FT                   /db_xref="InterPro:IPR019145"
FT                   /db_xref="UniParc:UPI0001830B7D"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1G9"
FT                   /transl_table=1
FT                   /translation="MAPVTLKTVDDDLKDVIQHLFEIQSAVHGYLGPETQQELVRKIKN
FT                   LTLALSTLSTHTQLPPTQENQPDANTDPSNPSLASIQLPPEIIDYVDSARNPDIYTREF
FT                   VELVQRGNQDLRGKREAFASFRDVLAREMRSAMPECRGEVDRVVAATSGAVDGPDGATE
FT                   AAATSGGLN"
     MAPVTLKTVD DDLKDVIQHL FEIQSAVHGY LGPETQQELV RKIKNLTLAL STLSTHTQLP        60
     PTQENQPDAN TDPSNPSLAS IQLPPEIIDY VDSARNPDIY TREFVELVQR GNQDLRGKRE       120
     AFASFRDVLA REMRSAMPEC RGEVDRVVAA TSGAVDGPDG ATEAAATSGG LN               172
//

If you have problems or comments...

PBIL Back to PBIL home page