(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE241

PENCW_10.PE241       Location/Qualifiers
FT   CDS             join(563010..563112,563221..563267,563326..563745,
FT                   563780..564296,564356..564743,564793..565402)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000235069" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949840"
FT                   /orf_name="Pc13g02410"
FT                   /product="Pc13g02410 protein"
FT                   /function="DNA binding"
FT                   /function="zinc ion binding"
FT                   /biological_process="transcription"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP91310.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006350"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="InterPro:IPR012531"
FT                   /db_xref="UniParc:UPI0001830B7E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1H3"
FT                   /transl_table=1
FT                   /translation="MKQISEDEFPDLMKYNASSKDPIGGSVFALSPEKAKSIDCQLGVV
FT                   QSKPRPTNHRIAELEQENEILRQKCAQLRSSNTISAGRVQSEPDHSVTSESTPRTPLPF
FT                   SRVTGIGLSWNDSPSTSTRDASHPEVPENDRRNTSLYHGPTSTVYDDTSPNHDEQNRPG
FT                   QSNEEGTRHFLFSQTARQSKLDLMQYEQLEPLNLAAGKLDFDGIDPEIGMHLLSIYWSR
FT                   QLYTAQIIYRPAFMRDMACEGPYFSKLLLNAIFFVVSKHCDRPELRSDPNDITTAGWKF
FT                   RQRFTQLLRDSFDKSEMTTLQALLIMSNALFSRCDERSLSWLYAGNAFNMFIDLGLHVL
FT                   PAVDSITAEELEIRKRVLWGAYLIDKIQCLFQGRPPLLNRVNLRASLDFLDDYDELEPF
FT                   QGITYMNTKPGVIPSLNVSLLTNLCELTTIVERILREIYSESRESNLIHRDRANISEEI
FT                   KSQLRTWRQNLPLRLDYLSFPDQAVFLPQSACLLALFNVLIILVHRPLIIGHDRVINST
FT                   TAHESVNACTAAANQIVQILHDYSQHFSLSSAPYMLSYATYISATIHARIVAQKGSNSS
FT                   MFQSLVLCRNILAEHTRLYSAAEKAKENLDKLISHLGISAADDNLRTGSPGSSGSNFPN
FT                   EHMVMDESINVAREPGVADGAVEFGSSLMSLELSDLDLEAIAQGFQVDVESHSFWNSLV
FT                   "
     MKQISEDEFP DLMKYNASSK DPIGGSVFAL SPEKAKSIDC QLGVVQSKPR PTNHRIAELE        60
     QENEILRQKC AQLRSSNTIS AGRVQSEPDH SVTSESTPRT PLPFSRVTGI GLSWNDSPST       120
     STRDASHPEV PENDRRNTSL YHGPTSTVYD DTSPNHDEQN RPGQSNEEGT RHFLFSQTAR       180
     QSKLDLMQYE QLEPLNLAAG KLDFDGIDPE IGMHLLSIYW SRQLYTAQII YRPAFMRDMA       240
     CEGPYFSKLL LNAIFFVVSK HCDRPELRSD PNDITTAGWK FRQRFTQLLR DSFDKSEMTT       300
     LQALLIMSNA LFSRCDERSL SWLYAGNAFN MFIDLGLHVL PAVDSITAEE LEIRKRVLWG       360
     AYLIDKIQCL FQGRPPLLNR VNLRASLDFL DDYDELEPFQ GITYMNTKPG VIPSLNVSLL       420
     TNLCELTTIV ERILREIYSE SRESNLIHRD RANISEEIKS QLRTWRQNLP LRLDYLSFPD       480
     QAVFLPQSAC LLALFNVLII LVHRPLIIGH DRVINSTTAH ESVNACTAAA NQIVQILHDY       540
     SQHFSLSSAP YMLSYATYIS ATIHARIVAQ KGSNSSMFQS LVLCRNILAE HTRLYSAAEK       600
     AKENLDKLIS HLGISAADDN LRTGSPGSSG SNFPNEHMVM DESINVAREP GVADGAVEFG       660
     SSLMSLELSD LDLEAIAQGF QVDVESHSFW NSLV                                   694
//

If you have problems or comments...

PBIL Back to PBIL home page