(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE244

PENCW_10.PE244       Location/Qualifiers
FT   CDS             complement(569181..570518)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000244785" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949841"
FT                   /orf_name="Pc13g02440"
FT                   /product="Pc13g02440 protein"
FT                   /biological_process="response to antibiotic"
FT                   /protein_id="CAP91313.1"
FT                   /db_xref="GO:0046677"
FT                   /db_xref="InterPro:IPR007815"
FT                   /db_xref="InterPro:IPR014622"
FT                   /db_xref="UniParc:UPI0001830B81"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J7"
FT                   /transl_table=1
FT                   /translation="MPQLQELFNSAVQPLPAIEDKGFASHFDTFAGSRVILLGDGSHGT
FT                   SEFYSARAEITKRLIERHGYTMVAVEADWPDAEAIDRYVRLRPGPKAQIGGKAKQYEPF
FT                   NRFPTWMWRNAEMQQLVEWMRDRNQALPPEQRAGFYGLDLYSMGASIRAVIEYLEKVDR
FT                   PTAKQARQRYGCLEPWVDEPTSYGLASLRGMEDCEAPVIKMLGELLEKRLEYASSHDGD
FT                   EYHSGEQNAHLVRDAEKYYKSMYYSSASSWNLRDTHMFDTLERLLKHNEGEKAIVWAHN
FT                   SHVGDARYTSMGYRRNEINIGQLCRERLGGDNVTILGCGTHTGTVAAAHEWDDDMEVMS
FT                   VRPSRDDSWEIVAHDTGVPSFVLELRKDRIDPALRAAMAAEQRLERFIGVIYRPDTERV
FT                   SHYSQAFLHKQLDGYIWFDRTQAVKPLEVIQPETPLGKGETYPFGL"
     MPQLQELFNS AVQPLPAIED KGFASHFDTF AGSRVILLGD GSHGTSEFYS ARAEITKRLI        60
     ERHGYTMVAV EADWPDAEAI DRYVRLRPGP KAQIGGKAKQ YEPFNRFPTW MWRNAEMQQL       120
     VEWMRDRNQA LPPEQRAGFY GLDLYSMGAS IRAVIEYLEK VDRPTAKQAR QRYGCLEPWV       180
     DEPTSYGLAS LRGMEDCEAP VIKMLGELLE KRLEYASSHD GDEYHSGEQN AHLVRDAEKY       240
     YKSMYYSSAS SWNLRDTHMF DTLERLLKHN EGEKAIVWAH NSHVGDARYT SMGYRRNEIN       300
     IGQLCRERLG GDNVTILGCG THTGTVAAAH EWDDDMEVMS VRPSRDDSWE IVAHDTGVPS       360
     FVLELRKDRI DPALRAAMAA EQRLERFIGV IYRPDTERVS HYSQAFLHKQ LDGYIWFDRT       420
     QAVKPLEVIQ PETPLGKGET YPFGL                                             445
//

If you have problems or comments...

PBIL Back to PBIL home page