(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE245

PENCW_10.PE245       Location/Qualifiers
FT   CDS             join(<570959..571793,571862..572229)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000210427" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129235"
FT                   /orf_name="Pc13g02450"
FT                   /product="Pc13g02450 protein"
FT                   /protein_id="CAP91314.1"
FT                   /db_xref="UniParc:UPI0001830C38"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J8"
FT                   /transl_table=1
FT                   /translation="LPVSSPSPRLDRCGQAMESLYGSFSNIEDPNTWTPPPRSGGHRGR
FT                   YLWTDAFGVVNFLTMHQEYKRTGNDTTGDDRYLVLAGRLIETVHDVLGKTRDGRSRLRG
FT                   ATDENPLSGGLRIGKTDARGPDGDGQYHHYLTVWMFALNRMAKASGDLKYNRQAIELAK
FT                   AIHPRFFVDRAAARPRMIWKMSMDLSEPLVKSEGNLDPIDGFVVFRLLQDTAMEAGDGA
FT                   FLAEEIDDYRRTMERKGEHFVSSDPLDLGMTLWTAHWFSGRERWAADLAGKCFEQIYNL
FT                   FEINQYLERNIKFRLAFREFGTCMGIQCQSEVKEKERTVDLKCYSDAIIAAWDPYMQLS
FT                   ISDDLTPADLRPITRVMYASALIPGGKLSQTILYDESGILTHFPIPAFQAGFLGPEPTP
FT                   T"
     LPVSSPSPRL DRCGQAMESL YGSFSNIEDP NTWTPPPRSG GHRGRYLWTD AFGVVNFLTM        60
     HQEYKRTGND TTGDDRYLVL AGRLIETVHD VLGKTRDGRS RLRGATDENP LSGGLRIGKT       120
     DARGPDGDGQ YHHYLTVWMF ALNRMAKASG DLKYNRQAIE LAKAIHPRFF VDRAAARPRM       180
     IWKMSMDLSE PLVKSEGNLD PIDGFVVFRL LQDTAMEAGD GAFLAEEIDD YRRTMERKGE       240
     HFVSSDPLDL GMTLWTAHWF SGRERWAADL AGKCFEQIYN LFEINQYLER NIKFRLAFRE       300
     FGTCMGIQCQ SEVKEKERTV DLKCYSDAII AAWDPYMQLS ISDDLTPADL RPITRVMYAS       360
     ALIPGGKLSQ TILYDESGIL THFPIPAFQA GFLGPEPTPT                             400
//

If you have problems or comments...

PBIL Back to PBIL home page