(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE246

PENCW_10.PE246       Location/Qualifiers
FT   CDS             join(complement(572914..573801),complement(572608..572682))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000210438" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672167"
FT                   /orf_name="Pc13g02460"
FT                   /product="Pc13g02460 protein"
FT                   /protein_id="CAP91315.1"
FT                   /db_xref="InterPro:IPR019388"
FT                   /db_xref="UniParc:UPI0001830C39"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1J9"
FT                   /transl_table=1
FT                   /translation="MATATARPVTLLSTVLLIYPATLLLGSLFSAISPTARHSRDLSGS
FT                   SPQPASPLAPSLATDLHLSESPVNYFARKNNIFNVYFVKIGWLWTTAAFVSLLIFQPLY
FT                   SPSRRESSSQQQARFRRTLQAILRYALATTVWYLATQWFFGPAIIDRGFVATGGKCERA
FT                   LEEVEKMTAGQSSPTGLETLFTAATCKAAGGAWRGGHDISGHVLMLVLATGLLAFEAVG
FT                   ASAHAPACVSQAGPTADAGRERKASDADSTPVIDSTETGGFARTWSLRLVWGVVGLGWW
FT                   MLFMTAIWFHTWLEKIALFSGMEKPSNRLHPDVETPGYT"
     MATATARPVT LLSTVLLIYP ATLLLGSLFS AISPTARHSR DLSGSSPQPA SPLAPSLATD        60
     LHLSESPVNY FARKNNIFNV YFVKIGWLWT TAAFVSLLIF QPLYSPSRRE SSSQQQARFR       120
     RTLQAILRYA LATTVWYLAT QWFFGPAIID RGFVATGGKC ERALEEVEKM TAGQSSPTGL       180
     ETLFTAATCK AAGGAWRGGH DISGHVLMLV LATGLLAFEA VGASAHAPAC VSQAGPTADA       240
     GRERKASDAD STPVIDSTET GGFARTWSLR LVWGVVGLGW WMLFMTAIWF HTWLEKIALF       300
     SGMEKPSNRL HPDVETPGYT                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page