(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE247

PENCW_10.PE247       Location/Qualifiers
FT   CDS             join(complement(575773..575881),complement(575626..575637),
FT                   complement(575435..575571),complement(574750..575378),
FT                   complement(574647..574677))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000168307" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672168"
FT                   /orf_name="Pc13g02470"
FT                   /product="Pc13g02470 protein"
FT                   /function="binding"
FT                   /biological_process="transmembrane transport"
FT                   /cellular_component="integral to membrane"
FT                   /cellular_component="mitochondrial inner membrane "
FT                   /protein_id="CAP91316.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0005743"
FT                   /db_xref="GO:0016021"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR001993"
FT                   /db_xref="InterPro:IPR002067"
FT                   /db_xref="InterPro:IPR018108"
FT                   /db_xref="UniParc:UPI0001830C3A"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K0"
FT                   /transl_table=1
FT                   /translation="METEVIDSIDKGNGGALRTIKDLTAGAVGGMAQVMLGQPFDIVKV
FT                   RLQTTTQYKSALECATQIFKKEGPTAFYKGTLTPLIGIGACVSVQFGAYHEARRRLEEL
FT                   NKKKYANSALSYTQYYMAGSFAGLTNSVLSGPIEHVRIRLQAQPHGAGRLYSGPIDCVS
FT                   KLAAQGGALRGIYRGQAVTLLREAQAYGAWFMAFEFMMNGDAKRNNIKREDMSKAKIAI
FT                   YGGLAGEVLWLSSYPFDVIKSKMQTDGFGAEQKFSTMRDCFKKTYAIEGLGGFWKGIGP
FT                   TLLRAMPVSAGTFLTVELAMQALG"
     METEVIDSID KGNGGALRTI KDLTAGAVGG MAQVMLGQPF DIVKVRLQTT TQYKSALECA        60
     TQIFKKEGPT AFYKGTLTPL IGIGACVSVQ FGAYHEARRR LEELNKKKYA NSALSYTQYY       120
     MAGSFAGLTN SVLSGPIEHV RIRLQAQPHG AGRLYSGPID CVSKLAAQGG ALRGIYRGQA       180
     VTLLREAQAY GAWFMAFEFM MNGDAKRNNI KREDMSKAKI AIYGGLAGEV LWLSSYPFDV       240
     IKSKMQTDGF GAEQKFSTMR DCFKKTYAIE GLGGFWKGIG PTLLRAMPVS AGTFLTVELA       300
     MQALG                                                                   305
//

If you have problems or comments...

PBIL Back to PBIL home page