(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE248

PENCW_10.PE248       Location/Qualifiers
FT   CDS             join(576150..576173,576224..579095,579157..579308)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000076907" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949842"
FT                   /orf_name="Pc13g02480"
FT                   /product="Pc13g02480 protein"
FT                   /function="GTP binding"
FT                   /function="GTPase activity"
FT                   /function="translation initiation factor activity "
FT                   /function="zinc ion binding"
FT                   /cellular_component="intracellular"
FT                   /protein_id="CAP91317.1"
FT                   /db_xref="GO:0003743"
FT                   /db_xref="GO:0003924"
FT                   /db_xref="GO:0005525"
FT                   /db_xref="GO:0005622"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000178"
FT                   /db_xref="InterPro:IPR000795"
FT                   /db_xref="InterPro:IPR001876"
FT                   /db_xref="InterPro:IPR004161"
FT                   /db_xref="InterPro:IPR005225"
FT                   /db_xref="InterPro:IPR006847"
FT                   /db_xref="InterPro:IPR009000"
FT                   /db_xref="InterPro:IPR015760"
FT                   /db_xref="InterPro:IPR023115"
FT                   /db_xref="UniParc:UPI0001830C3B"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K1"
FT                   /transl_table=1
FT                   /translation="MHRRPICRLSRRAEWSNSAYRTPTLTALTARRTIRLSATRWNSLG
FT                   PSNENDDGTASNPAPTKPKFGSRWGSKQATPSAGLSFAEQAMRQTLVANNQPPPPVPAP
FT                   TQRRQERSNQQLNSGQSNQQRKPYVRRVSPRDNQDAHMMGSRETPRHQRRSPFGQEKNP
FT                   FKEENTGSYTRWPKGSSRNQERNPFSRGTKPAFEEENPFAPEKTQNRFQGQFQNRATRD
FT                   HPMAHNDWKCPECMKHVFASKQVCPFCKASRPSDAQPKFRITREYSDSPGPSQFKQSRS
FT                   PSEYTSKFQQLGESVLTELEQDVQPNTTETTKRHSEKSDRPRTKEEAEDFKKNQWSWDM
FT                   SALEQLENLEEQEQPPPSKPMKRREGRKGRENESDGADFDSEDRERLRAERRRQQKEKN
FT                   AQRAAKKAAAQAAPAPLYLPEFISVSNLADVIGVRPAQFVQRMEDMGFEEITYRDILDA
FT                   ETAGLVAAEFNYEAIFDSGKADLHAAPELEDTSGLPPRPPVVTIMGHVDHGKTTILDWL
FT                   RKSSVAASEHGGITQHIGAFSVMMPSGKAITFLDTPGHSAFLEMRRRGADVTDIVVLVV
FT                   AADDSVKPQTIEAIKHATQAKVPVIVAISKIDKEGNNPDRVKGDLSVHGIHVEDYGGDV
FT                   QAIGVSGKTGQGMVELEEAIVALSEMLDHRASTTCNVEGWVIEASTKSYGRVASALIRR
FT                   GTLRPGDIIVAGTAWARVRTLRNEAGVAISEATPGMPVEIDGWREQPGAGTELLQAPTE
FT                   QKAKDVVDYRLEKSDTQKMGIDMVAINEARRELLEKRRRENEDEETAKEVEPTGPKSVN
FT                   FVLKGDVDGSVEAVLNSVAAVGNNEVFANIIRSGVGPVSEFDIEHAGSANGKIVSFNQA
FT                   IDPNIMRIAEAEGVDILDHNIIYKLIDDIKAILSEKLPPTITTRVTGEAEVQQVFEITV
FT                   KGREKTAIAGSRVRNGLINKTRKVRVLRGEEIVYDGAMVSLKNVKKDVTEMRKDTECGI
FT                   AFENWTGFAPGDHVQCYEEISEKRYL"
     MHRRPICRLS RRAEWSNSAY RTPTLTALTA RRTIRLSATR WNSLGPSNEN DDGTASNPAP        60
     TKPKFGSRWG SKQATPSAGL SFAEQAMRQT LVANNQPPPP VPAPTQRRQE RSNQQLNSGQ       120
     SNQQRKPYVR RVSPRDNQDA HMMGSRETPR HQRRSPFGQE KNPFKEENTG SYTRWPKGSS       180
     RNQERNPFSR GTKPAFEEEN PFAPEKTQNR FQGQFQNRAT RDHPMAHNDW KCPECMKHVF       240
     ASKQVCPFCK ASRPSDAQPK FRITREYSDS PGPSQFKQSR SPSEYTSKFQ QLGESVLTEL       300
     EQDVQPNTTE TTKRHSEKSD RPRTKEEAED FKKNQWSWDM SALEQLENLE EQEQPPPSKP       360
     MKRREGRKGR ENESDGADFD SEDRERLRAE RRRQQKEKNA QRAAKKAAAQ AAPAPLYLPE       420
     FISVSNLADV IGVRPAQFVQ RMEDMGFEEI TYRDILDAET AGLVAAEFNY EAIFDSGKAD       480
     LHAAPELEDT SGLPPRPPVV TIMGHVDHGK TTILDWLRKS SVAASEHGGI TQHIGAFSVM       540
     MPSGKAITFL DTPGHSAFLE MRRRGADVTD IVVLVVAADD SVKPQTIEAI KHATQAKVPV       600
     IVAISKIDKE GNNPDRVKGD LSVHGIHVED YGGDVQAIGV SGKTGQGMVE LEEAIVALSE       660
     MLDHRASTTC NVEGWVIEAS TKSYGRVASA LIRRGTLRPG DIIVAGTAWA RVRTLRNEAG       720
     VAISEATPGM PVEIDGWREQ PGAGTELLQA PTEQKAKDVV DYRLEKSDTQ KMGIDMVAIN       780
     EARRELLEKR RRENEDEETA KEVEPTGPKS VNFVLKGDVD GSVEAVLNSV AAVGNNEVFA       840
     NIIRSGVGPV SEFDIEHAGS ANGKIVSFNQ AIDPNIMRIA EAEGVDILDH NIIYKLIDDI       900
     KAILSEKLPP TITTRVTGEA EVQQVFEITV KGREKTAIAG SRVRNGLINK TRKVRVLRGE       960
     EIVYDGAMVS LKNVKKDVTE MRKDTECGIA FENWTGFAPG DHVQCYEEIS EKRYL           1015
//

If you have problems or comments...

PBIL Back to PBIL home page