(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE25

PENCW_10.PE25        Location/Qualifiers
FT   CDS             complement(59920..61287)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234693" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824587"
FT                   /orf_name="Pc13g00250"
FT                   /product="Pc13g00250 protein"
FT                   /protein_id="CAP91094.1"
FT                   /db_xref="UniParc:UPI0001830DC0"
FT                   /db_xref="UniProtKB/TrEMBL:B6H5H8"
FT                   /transl_table=1
FT                   /translation="MINHSFSNCDESQAQDLDPSDQDSQYAPTPGYYVHTPPSEYGFSP
FT                   SPNRCPHDGAEPLLSTPAETSKLLQLSEWEANRPDDELPASFIRYTIEWKVKVNNRSIS
FT                   EDTEQDVALTPSAYWPLILRDKLYKVIEEKVARKRRVRSDDTSIVVSINDRKQRDLKKR
FT                   FNGLNIDWSAVEKQILVWGKFHASGKELRLKIIFSYIEDDHSPRSATGRNDKRGKSSVT
FT                   KRMLNERDEQLDAEQHATGEQSIWRAVYTLMRCPSPSCHLGPHCWQDPHGKKHYQLRTH
FT                   HLKRLITYVEGGGILECQDDVPDAVREELFLEEQQKVERLRSKGNKMLAAGNCPPISIN
FT                   FMGGQHHLQSPAANSIVTSANSPPQHGQTADPLIIDGPRDLAVREYSAWQETNVVDDNL
FT                   KAQFRQACDVTLANGLDLEQIHEDHDAGFFIEKGVAVGIARRFVSDISRWVRHVRN"
     MINHSFSNCD ESQAQDLDPS DQDSQYAPTP GYYVHTPPSE YGFSPSPNRC PHDGAEPLLS        60
     TPAETSKLLQ LSEWEANRPD DELPASFIRY TIEWKVKVNN RSISEDTEQD VALTPSAYWP       120
     LILRDKLYKV IEEKVARKRR VRSDDTSIVV SINDRKQRDL KKRFNGLNID WSAVEKQILV       180
     WGKFHASGKE LRLKIIFSYI EDDHSPRSAT GRNDKRGKSS VTKRMLNERD EQLDAEQHAT       240
     GEQSIWRAVY TLMRCPSPSC HLGPHCWQDP HGKKHYQLRT HHLKRLITYV EGGGILECQD       300
     DVPDAVREEL FLEEQQKVER LRSKGNKMLA AGNCPPISIN FMGGQHHLQS PAANSIVTSA       360
     NSPPQHGQTA DPLIIDGPRD LAVREYSAWQ ETNVVDDNLK AQFRQACDVT LANGLDLEQI       420
     HEDHDAGFFI EKGVAVGIAR RFVSDISRWV RHVRN                                  455
//

If you have problems or comments...

PBIL Back to PBIL home page