(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_10.PE251

PENCW_10.PE251       Location/Qualifiers
FT   CDS             join(complement(584603..584791),complement(584024..584551))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000248342" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949843"
FT                   /orf_name="Pc13g02510"
FT                   /product="Pc13g02510 protein"
FT                   /function="hydrolase activity, acting on acid halide bonds,
FT                   in C-halide compounds"
FT                   /protein_id="CAP91320.1"
FT                   /db_xref="GO:0019120"
FT                   /db_xref="InterPro:IPR005833"
FT                   /db_xref="InterPro:IPR006328"
FT                   /db_xref="InterPro:IPR006388"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="UniParc:UPI0001830C3E"
FT                   /db_xref="UniProtKB/TrEMBL:B6H1K3"
FT                   /transl_table=1
FT                   /translation="MTAKTVVAFDLYGTLLSTESIAKQLEKRCDNAKAQSISALWRRYQ
FT                   LEYTWRLNSMGKPHFQSSTRNSLLHALADNNEQLSDDHIEHLMQAYNDLSTFSDVNPAL
FT                   AQIAADPSIQAVIFSNGTKTMLSNSVLRSKDLSPHASVFQDIVTVDEVQQYKPSKASYE
FT                   HLAKQTGQDPLQMSKLWLISGNPFDIVGARATGMQAIWVDRVGAGWKDAVAPDLQPTAI
FT                   VHDLKHIVKEINRHQI"
     MTAKTVVAFD LYGTLLSTES IAKQLEKRCD NAKAQSISAL WRRYQLEYTW RLNSMGKPHF        60
     QSSTRNSLLH ALADNNEQLS DDHIEHLMQA YNDLSTFSDV NPALAQIAAD PSIQAVIFSN       120
     GTKTMLSNSV LRSKDLSPHA SVFQDIVTVD EVQQYKPSKA SYEHLAKQTG QDPLQMSKLW       180
     LISGNPFDIV GARATGMQAI WVDRVGAGWK DAVAPDLQPT AIVHDLKHIV KEINRHQI         238
//

If you have problems or comments...

PBIL Back to PBIL home page